Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CJZ71_RS03100 Genome accession   NZ_CP022891
Coordinates   538221..538394 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain DKU_NT_03     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 533221..543394
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJZ71_RS03085 (CJZ71_03085) gcvT 534021..535109 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  CJZ71_RS03090 (CJZ71_03090) hepAA 535550..537223 (+) 1674 WP_038829735.1 SNF2-related protein -
  CJZ71_RS03095 (CJZ71_03095) yqhG 537244..538038 (+) 795 WP_014480249.1 YqhG family protein -
  CJZ71_RS03100 (CJZ71_03100) sinI 538221..538394 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  CJZ71_RS03105 (CJZ71_03105) sinR 538428..538763 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CJZ71_RS03110 (CJZ71_03110) tasA 538856..539641 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  CJZ71_RS03115 (CJZ71_03115) sipW 539705..540277 (-) 573 WP_003230181.1 signal peptidase I SipW -
  CJZ71_RS03120 (CJZ71_03120) tapA 540261..541022 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  CJZ71_RS03125 (CJZ71_03125) yqzG 541294..541620 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  CJZ71_RS03130 (CJZ71_03130) spoIITA 541662..541841 (-) 180 WP_014480252.1 YqzE family protein -
  CJZ71_RS03135 (CJZ71_03135) comGG 541912..542286 (-) 375 WP_069837632.1 ComG operon protein ComGG Machinery gene
  CJZ71_RS03140 (CJZ71_03140) comGF 542287..542670 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  CJZ71_RS03145 (CJZ71_03145) comGE 542696..543043 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=202926 CJZ71_RS03100 WP_003230187.1 538221..538394(+) (sinI) [Bacillus subtilis strain DKU_NT_03]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=202926 CJZ71_RS03100 WP_003230187.1 538221..538394(+) (sinI) [Bacillus subtilis strain DKU_NT_03]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1