Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BK049_RS12760 Genome accession   NZ_CP017786
Coordinates   2527410..2527550 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus xiamenensis strain VV3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2522410..2532550
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BK049_RS12735 (BK049_12735) - 2522644..2523051 (+) 408 WP_008357193.1 YueI family protein -
  BK049_RS12740 (BK049_12740) - 2523112..2523663 (+) 552 WP_008357192.1 isochorismatase family cysteine hydrolase -
  BK049_RS12745 (BK049_12745) - 2523681..2525150 (+) 1470 WP_008357190.1 nicotinate phosphoribosyltransferase -
  BK049_RS12750 (BK049_12750) - 2525290..2526516 (+) 1227 WP_008357188.1 HDOD domain-containing protein -
  BK049_RS12755 (BK049_12755) - 2526551..2526904 (-) 354 WP_034738645.1 hypothetical protein -
  BK049_RS12760 (BK049_12760) degQ 2527410..2527550 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BK049_RS12765 (BK049_12765) - 2527703..2528617 (+) 915 WP_008357184.1 polyprenyl synthetase family protein -
  BK049_RS18990 comX 2528614..2528784 (+) 171 WP_008357181.1 competence pheromone ComX -
  BK049_RS12770 (BK049_12770) comP 2528838..2531159 (+) 2322 WP_008357179.1 ATP-binding protein Regulator
  BK049_RS12775 (BK049_12775) comA 2531240..2531881 (+) 642 WP_008357178.1 response regulator transcription factor Regulator
  BK049_RS12780 (BK049_12780) - 2531905..2532294 (+) 390 WP_008357176.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=202927 BK049_RS12760 WP_003213123.1 2527410..2527550(+) (degQ) [Bacillus xiamenensis strain VV3]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=202927 BK049_RS12760 WP_003213123.1 2527410..2527550(+) (degQ) [Bacillus xiamenensis strain VV3]
ATGGAAAAGTATGAAATCGAAGAACTGAAACAACTATTATGGAAACTCGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment