Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BK055_RS16095 Genome accession   NZ_CP017775
Coordinates   3252605..3252745 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 9912D     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3247605..3257745
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BK055_RS16070 (BK055_16070) - 3247932..3248315 (-) 384 WP_065180456.1 hotdog fold thioesterase -
  BK055_RS16075 (BK055_16075) comA 3248337..3248981 (-) 645 WP_071181952.1 response regulator transcription factor Regulator
  BK055_RS16080 (BK055_16080) comP 3249062..3251368 (-) 2307 WP_071181953.1 sensor histidine kinase Regulator
  BK055_RS16085 (BK055_16085) comX 3251387..3251563 (-) 177 WP_017419424.1 competence pheromone ComX -
  BK055_RS16090 (BK055_16090) - 3251578..3252453 (-) 876 WP_026092320.1 polyprenyl synthetase family protein -
  BK055_RS16095 (BK055_16095) degQ 3252605..3252745 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BK055_RS16100 (BK055_16100) - 3253210..3253551 (+) 342 WP_014418765.1 hypothetical protein -
  BK055_RS16105 (BK055_16105) - 3253558..3254781 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  BK055_RS16110 (BK055_16110) - 3254911..3256377 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BK055_RS16115 (BK055_16115) - 3256395..3256946 (-) 552 WP_017419426.1 cysteine hydrolase family protein -
  BK055_RS16120 (BK055_16120) - 3257043..3257441 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=202836 BK055_RS16095 WP_003152043.1 3252605..3252745(-) (degQ) [Bacillus velezensis strain 9912D]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=202836 BK055_RS16095 WP_003152043.1 3252605..3252745(-) (degQ) [Bacillus velezensis strain 9912D]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment