Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BKP58_RS18100 Genome accession   NZ_CP017763
Coordinates   3373105..3373245 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 29R7-12     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3368105..3378245
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKP58_RS18075 (BKP58_18015) yueI 3368401..3368799 (+) 399 WP_014480710.1 YueI family protein -
  BKP58_RS18080 (BKP58_18020) pncA 3368896..3369447 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  BKP58_RS18085 (BKP58_18025) pncB 3369463..3370935 (+) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  BKP58_RS18090 (BKP58_18030) pdeH 3371071..3372300 (+) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  BKP58_RS18095 (BKP58_18035) - 3372276..3372644 (-) 369 WP_014477834.1 hypothetical protein -
  BKP58_RS22780 - 3372758..3372883 (-) 126 WP_003228793.1 hypothetical protein -
  BKP58_RS18100 (BKP58_18040) degQ 3373105..3373245 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BKP58_RS18105 (BKP58_18045) - 3373430..3374293 (+) 864 WP_014480705.1 polyprenyl synthetase family protein -
  BKP58_RS18110 (BKP58_18050) comX 3374295..3374516 (+) 222 WP_014480704.1 competence pheromone ComX -
  BKP58_RS18115 (BKP58_18055) comP 3374532..3376844 (+) 2313 WP_014480703.1 sensor histidine kinase Regulator
  BKP58_RS18120 (BKP58_18060) comA 3376925..3377569 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BKP58_RS18125 (BKP58_18065) yuxO 3377588..3377968 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=202688 BKP58_RS18100 WP_003220708.1 3373105..3373245(+) (degQ) [Bacillus subtilis strain 29R7-12]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=202688 BKP58_RS18100 WP_003220708.1 3373105..3373245(+) (degQ) [Bacillus subtilis strain 29R7-12]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment