Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BKN48_RS01780 Genome accession   NZ_CP017676
Coordinates   299502..299885 (-) Length   127 a.a.
NCBI ID   WP_070547529.1    Uniprot ID   -
Organism   Bacillus subtilis strain VV2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 294502..304885
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKN48_RS01740 (BKN48_01740) sinI 295436..295609 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  BKN48_RS01745 (BKN48_01745) sinR 295643..295978 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BKN48_RS01750 (BKN48_01750) tasA 296070..296855 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  BKN48_RS01755 (BKN48_01755) sipW 296920..297492 (-) 573 WP_080481282.1 signal peptidase I SipW -
  BKN48_RS01760 (BKN48_01760) tapA 297476..298237 (-) 762 WP_070547528.1 amyloid fiber anchoring/assembly protein TapA -
  BKN48_RS01765 (BKN48_01765) yqzG 298508..298834 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  BKN48_RS01770 (BKN48_01770) spoIITA 298876..299055 (-) 180 WP_014480252.1 YqzE family protein -
  BKN48_RS01775 (BKN48_01775) comGG 299127..299501 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  BKN48_RS01780 (BKN48_01780) comGF 299502..299885 (-) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  BKN48_RS01785 (BKN48_01785) comGE 299911..300258 (-) 348 WP_070547530.1 ComG operon protein 5 Machinery gene
  BKN48_RS01790 (BKN48_01790) comGD 300242..300673 (-) 432 WP_070547531.1 comG operon protein ComGD Machinery gene
  BKN48_RS01795 (BKN48_01795) comGC 300663..300959 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BKN48_RS01800 (BKN48_01800) comGB 300973..302010 (-) 1038 WP_070547532.1 comG operon protein ComGB Machinery gene
  BKN48_RS01805 (BKN48_01805) comGA 301997..303067 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  BKN48_RS21640 (BKN48_01810) - 303278..303412 (-) 135 WP_257786427.1 hypothetical protein -
  BKN48_RS01815 (BKN48_01815) corA 303478..304431 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14257.35 Da        Isoelectric Point: 6.2112

>NTDB_id=201462 BKN48_RS01780 WP_070547529.1 299502..299885(-) (comGF) [Bacillus subtilis strain VV2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKASQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=201462 BKN48_RS01780 WP_070547529.1 299502..299885(-) (comGF) [Bacillus subtilis strain VV2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGCGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGATATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment