Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSBS38_RS12555 Genome accession   NZ_CP017314
Coordinates   2351629..2351802 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BS38     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2346629..2356802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSBS38_RS12540 (BSBS38_02527) gcvT 2347428..2348516 (-) 1089 WP_069964209.1 glycine cleavage system aminomethyltransferase GcvT -
  BSBS38_RS12545 (BSBS38_02528) hepAA 2348958..2350631 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  BSBS38_RS12550 (BSBS38_02529) yqhG 2350652..2351446 (+) 795 WP_014480249.1 YqhG family protein -
  BSBS38_RS12555 (BSBS38_02530) sinI 2351629..2351802 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSBS38_RS12560 (BSBS38_02531) sinR 2351836..2352177 (+) 342 WP_080478414.1 transcriptional regulator SinR Regulator
  BSBS38_RS12565 (BSBS38_02532) tasA 2352263..2353048 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSBS38_RS12570 (BSBS38_02533) sipW 2353112..2353684 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSBS38_RS12575 (BSBS38_02534) tapA 2353668..2354429 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSBS38_RS12580 (BSBS38_02535) yqzG 2354701..2355027 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSBS38_RS12585 (BSBS38_02536) spoIITA 2355069..2355248 (-) 180 WP_014480252.1 YqzE family protein -
  BSBS38_RS12590 (BSBS38_02537) comGG 2355319..2355693 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSBS38_RS12595 (BSBS38_02538) comGF 2355694..2356077 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSBS38_RS12600 (BSBS38_02539) comGE 2356103..2356450 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=197623 BSBS38_RS12555 WP_003230187.1 2351629..2351802(+) (sinI) [Bacillus subtilis strain BS38]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=197623 BSBS38_RS12555 WP_003230187.1 2351629..2351802(+) (sinI) [Bacillus subtilis strain BS38]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment