Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSBS38_RS12595 Genome accession   NZ_CP017314
Coordinates   2355694..2356077 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain BS38     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2350694..2361077
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSBS38_RS12555 (BSBS38_02530) sinI 2351629..2351802 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSBS38_RS12560 (BSBS38_02531) sinR 2351836..2352177 (+) 342 WP_080478414.1 transcriptional regulator SinR Regulator
  BSBS38_RS12565 (BSBS38_02532) tasA 2352263..2353048 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSBS38_RS12570 (BSBS38_02533) sipW 2353112..2353684 (-) 573 WP_003230181.1 signal peptidase I SipW -
  BSBS38_RS12575 (BSBS38_02534) tapA 2353668..2354429 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSBS38_RS12580 (BSBS38_02535) yqzG 2354701..2355027 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSBS38_RS12585 (BSBS38_02536) spoIITA 2355069..2355248 (-) 180 WP_014480252.1 YqzE family protein -
  BSBS38_RS12590 (BSBS38_02537) comGG 2355319..2355693 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSBS38_RS12595 (BSBS38_02538) comGF 2355694..2356077 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSBS38_RS12600 (BSBS38_02539) comGE 2356103..2356450 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BSBS38_RS12605 (BSBS38_02540) comGD 2356434..2356865 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  BSBS38_RS12610 (BSBS38_02541) comGC 2356855..2357151 (-) 297 WP_069964211.1 comG operon protein ComGC Machinery gene
  BSBS38_RS12615 (BSBS38_02542) comGB 2357165..2358202 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  BSBS38_RS12620 (BSBS38_02543) comGA 2358189..2359259 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSBS38_RS12630 (BSBS38_02544) - 2359471..2359668 (-) 198 WP_014480259.1 CBS domain-containing protein -
  BSBS38_RS12635 (BSBS38_02545) corA 2359670..2360623 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=197626 BSBS38_RS12595 WP_014480254.1 2355694..2356077(-) (comGF) [Bacillus subtilis strain BS38]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=197626 BSBS38_RS12595 WP_014480254.1 2355694..2356077(-) (comGF) [Bacillus subtilis strain BS38]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment