Detailed information NTG0197025

Bioinformatically predicted

Overview

• Name: comE
• Type: Machinery gene
• Locus tag: BFO62_RS13685
• Genome accession: NZ_CP017257
• Coordinates: 1907962..1908426 (-)
• Length: 154 a.a.
• NCBI ID: WP_011798959.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain COL-201504-11
• Function: DNA binding (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1900483..1918477	1907962..1908426	within	0

Gene organization within MGE regions

Location: 1900483..1918477

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BFO62_RS10935	-	1900483..1901234 (+)	752	WP_096001759.1	IS5-like element IS1301 family transposase	-
BFO62_RS14120 (BFO62_09885)	-	1901216..1901698 (-)	483	WP_061729868.1	hypothetical protein	-
BFO62_RS14125	-	1901866..1902030 (-)	165	WP_002239497.1	hypothetical protein	-
BFO62_RS10955 (BFO62_09890)	-	1902980..1903225 (-)	246	WP_002224299.1	hypothetical protein	-
BFO62_RS10960 (BFO62_09900)	-	1903337..1903765 (+)	429	WP_002212270.1	CopD family protein	-
BFO62_RS10965 (BFO62_09905)	-	1903777..1904253 (+)	477	WP_002224298.1	CYTH domain-containing protein	-
BFO62_RS10975 (BFO62_09910)	-	1904603..1905091 (-)	489	WP_002224297.1	dihydrofolate reductase	-
BFO62_RS10980 (BFO62_09915)	aroG	1905159..1906214 (-)	1056	WP_002216371.1	3-deoxy-7-phosphoheptulonate synthase AroG	-
BFO62_RS13330	-	1906376..1906603 (-)	228	WP_153310284.1	hypothetical protein	-
BFO62_RS10990 (BFO62_09920)	-	1906877..1907134 (+)	258	WP_002247771.1	hypothetical protein	-
BFO62_RS13675	-	1907183..1907287 (-)	105	Protein_1853	IS1595 family transposase	-
BFO62_RS13685 (BFO62_09930)	comE	1907962..1908426 (-)	465	WP_011798959.1	ComEA family DNA-binding protein	Machinery gene
BFO62_RS11040 (BFO62_09965)	-	1914224..1915030 (-)	807	WP_076612651.1	inner membrane protein YpjD	-
BFO62_RS11045 (BFO62_09970)	ffh	1915251..1916621 (+)	1371	WP_076612650.1	signal recognition particle protein	-
BFO62_RS11050 (BFO62_09975)	dsbA2	1916952..1917647 (-)	696	WP_002215704.1	thiol:disulfide interchange protein DsbA/DsbL	Machinery gene
BFO62_RS11055 (BFO62_09980)	-	1917818..1918477 (-)	660	WP_002218694.1	NYN domain-containing protein	-

Sequence

Protein

• Length: 154 a.a.
• Molecular weight: 16563.76 Da
• Isoelectric Point: 10.8773

>NTDB_id=197025 BFO62_RS13685 WP_011798959.1 1907962..1908426(-) (comE) [Neisseria meningitidis strain COL-201504-11]
MLYPEKMSGMAGRHPYGVRSGLRRNGLKLWDIHFRMTRFIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINA
ASQQELEALPGIGPAKAKAIAEYRAQNGAFKSVDDLTKVKGIGPAVLAKLKDQASVGAPAPKGPAKPALPADKK

Nucleotide

• Length: 465 bp

>NTDB_id=197025 BFO62_RS13685 WP_011798959.1 1907962..1908426(-) (comE) [Neisseria meningitidis strain COL-201504-11]
TTGCTTTACCCGGAAAAAATGTCGGGGATGGCGGGACGGCATCCGTACGGCGTCCGGTCGGGTTTGCGGAGGAACGGCTT
GAAACTTTGGGATATTCATTTTAGAATGACTCGTTTTATCGTCGCAAGATGCGGTTTATTGTTTGCAACCCTTAAAGGAA
AAACCATGAAGAAAATGTTCGTGCTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAAACATCAATGCG
GCTTCGCAGCAGGAGTTGGAGGCGCTGCCGGGCATAGGCCCTGCGAAGGCGAAGGCCATTGCGGAATACCGTGCGCAAAA
CGGTGCGTTCAAGTCTGTGGACGATTTGACCAAGGTAAAGGGCATCGGCCCTGCGGTGCTGGCGAAGCTGAAGGATCAGG
CTTCTGTCGGCGCGCCCGCACCAAAAGGCCCGGCAAAACCGGCTCTGCCCGCGGATAAAAAATAG

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (75-133)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74
comE	Neisseria gonorrhoeae MS11	93.443	79.221	0.74