Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BS16045_RS13270 Genome accession   NZ_CP017112
Coordinates   2528497..2528871 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis strain BS16045     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2523497..2533871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS16045_RS13230 (BS16045_02607) yqhG 2523829..2524623 (+) 795 WP_003230200.1 YqhG family protein -
  BS16045_RS13235 (BS16045_02608) sinI 2524806..2524979 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BS16045_RS13240 (BS16045_02609) sinR 2525013..2525348 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BS16045_RS13245 (BS16045_02610) tasA 2525441..2526226 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BS16045_RS13250 (BS16045_02611) sipW 2526290..2526862 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BS16045_RS13255 (BS16045_02612) tapA 2526846..2527607 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BS16045_RS13260 (BS16045_02613) yqzG 2527879..2528205 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BS16045_RS13265 (BS16045_02614) spoIITA 2528247..2528426 (-) 180 WP_003230176.1 YqzE family protein -
  BS16045_RS13270 (BS16045_02615) comGG 2528497..2528871 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  BS16045_RS13275 (BS16045_02616) comGF 2528872..2529255 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  BS16045_RS13280 (BS16045_02617) comGE 2529281..2529628 (-) 348 WP_069322754.1 ComG operon protein 5 Machinery gene
  BS16045_RS13285 (BS16045_02618) comGD 2529612..2530043 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  BS16045_RS13290 (BS16045_02619) comGC 2530033..2530329 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BS16045_RS13295 (BS16045_02620) comGB 2530343..2531380 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  BS16045_RS13300 (BS16045_02621) comGA 2531367..2532437 (-) 1071 WP_069322755.1 competence protein ComGA Machinery gene
  BS16045_RS22925 (BS16045_02622) - 2532649..2532846 (-) 198 WP_069322756.1 CBS domain-containing protein -
  BS16045_RS13315 (BS16045_02623) corA 2532848..2533801 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=195701 BS16045_RS13270 WP_029726722.1 2528497..2528871(-) (comGG) [Bacillus subtilis strain BS16045]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=195701 BS16045_RS13270 WP_029726722.1 2528497..2528871(-) (comGG) [Bacillus subtilis strain BS16045]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment