Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BS16045_RS13235 Genome accession   NZ_CP017112
Coordinates   2524806..2524979 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain BS16045     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2519806..2529979
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS16045_RS13220 (BS16045_02605) gcvT 2520605..2521693 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  BS16045_RS13225 (BS16045_02606) hepAA 2522135..2523808 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  BS16045_RS13230 (BS16045_02607) yqhG 2523829..2524623 (+) 795 WP_003230200.1 YqhG family protein -
  BS16045_RS13235 (BS16045_02608) sinI 2524806..2524979 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BS16045_RS13240 (BS16045_02609) sinR 2525013..2525348 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BS16045_RS13245 (BS16045_02610) tasA 2525441..2526226 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BS16045_RS13250 (BS16045_02611) sipW 2526290..2526862 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BS16045_RS13255 (BS16045_02612) tapA 2526846..2527607 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BS16045_RS13260 (BS16045_02613) yqzG 2527879..2528205 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BS16045_RS13265 (BS16045_02614) spoIITA 2528247..2528426 (-) 180 WP_003230176.1 YqzE family protein -
  BS16045_RS13270 (BS16045_02615) comGG 2528497..2528871 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  BS16045_RS13275 (BS16045_02616) comGF 2528872..2529255 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  BS16045_RS13280 (BS16045_02617) comGE 2529281..2529628 (-) 348 WP_069322754.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=195699 BS16045_RS13235 WP_003230187.1 2524806..2524979(+) (sinI) [Bacillus subtilis strain BS16045]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=195699 BS16045_RS13235 WP_003230187.1 2524806..2524979(+) (sinI) [Bacillus subtilis strain BS16045]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment