Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BARD7_RS13825 Genome accession   NZ_CP016913
Coordinates   2798866..2799006 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain RD7-7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2793866..2804006
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BARD7_RS13800 (BARD7_02826) - 2794165..2794548 (-) 384 WP_065982198.1 hotdog fold thioesterase -
  BARD7_RS13805 (BARD7_02827) comA 2794570..2795214 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  BARD7_RS13810 (BARD7_02828) comP 2795295..2797601 (-) 2307 WP_065982199.1 sensor histidine kinase Regulator
  BARD7_RS13815 (BARD7_02829) - 2797620..2797799 (-) 180 WP_269465882.1 competence pheromone ComX -
  BARD7_RS13820 (BARD7_02830) comQ 2797803..2798735 (-) 933 WP_269465883.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BARD7_RS13825 (BARD7_02831) degQ 2798866..2799006 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  BARD7_RS13830 (BARD7_02832) - 2799471..2799812 (+) 342 WP_065982200.1 hypothetical protein -
  BARD7_RS13835 (BARD7_02833) - 2799819..2801042 (-) 1224 WP_065982201.1 EAL and HDOD domain-containing protein -
  BARD7_RS13840 (BARD7_02834) - 2801172..2802638 (-) 1467 WP_115997037.1 nicotinate phosphoribosyltransferase -
  BARD7_RS13845 (BARD7_02835) - 2802656..2803207 (-) 552 WP_045509472.1 cysteine hydrolase family protein -
  BARD7_RS13850 (BARD7_02836) - 2803286..2803681 (-) 396 WP_013353403.1 YueI family protein -
  BARD7_RS13855 (BARD7_02837) - 2803747..2803995 (-) 249 WP_003152028.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=193651 BARD7_RS13825 WP_013353398.1 2798866..2799006(-) (degQ) [Bacillus amyloliquefaciens strain RD7-7]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=193651 BARD7_RS13825 WP_013353398.1 2798866..2799006(-) (degQ) [Bacillus amyloliquefaciens strain RD7-7]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913

Multiple sequence alignment