Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | S100757_RS12695 | Genome accession | NZ_CP021499 |
| Coordinates | 2368728..2368901 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain SRCM100757 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2363728..2373901
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S100757_RS12680 (S100757_02514) | gcvT | 2364527..2365615 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| S100757_RS12685 (S100757_02515) | hepAA | 2366057..2367730 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| S100757_RS12690 (S100757_02516) | yqhG | 2367751..2368545 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| S100757_RS12695 (S100757_02517) | sinI | 2368728..2368901 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| S100757_RS12700 (S100757_02518) | sinR | 2368935..2369270 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| S100757_RS12705 (S100757_02519) | tasA | 2369363..2370148 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| S100757_RS12710 (S100757_02520) | sipW | 2370212..2370784 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| S100757_RS12715 (S100757_02521) | tapA | 2370768..2371529 (-) | 762 | WP_087614619.1 | amyloid fiber anchoring/assembly protein TapA | - |
| S100757_RS12720 (S100757_02522) | yqzG | 2371801..2372127 (+) | 327 | WP_029317915.1 | YqzG/YhdC family protein | - |
| S100757_RS12725 (S100757_02523) | spoIITA | 2372169..2372348 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| S100757_RS12730 (S100757_02524) | comGG | 2372419..2372793 (-) | 375 | WP_015714252.1 | ComG operon protein ComGG | Machinery gene |
| S100757_RS12735 (S100757_02525) | comGF | 2372794..2373177 (-) | 384 | WP_076458111.1 | ComG operon protein ComGF | Machinery gene |
| S100757_RS12740 (S100757_02526) | comGE | 2373203..2373550 (-) | 348 | WP_087614620.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=193378 S100757_RS12695 WP_003230187.1 2368728..2368901(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM100757]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=193378 S100757_RS12695 WP_003230187.1 2368728..2368901(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM100757]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |