Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   A4W75_RS05695 Genome accession   NZ_CP016467
Coordinates   1093709..1094017 (-) Length   102 a.a.
NCBI ID   WP_004270901.1    Uniprot ID   A0AAJ0LFY3
Organism   Latilactobacillus curvatus strain TMW 1.27     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1088709..1099017
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A4W75_RS05660 (A4W75_05475) - 1089379..1089831 (-) 453 WP_056967146.1 hypothetical protein -
  A4W75_RS05665 (A4W75_05480) - 1089891..1091084 (-) 1194 WP_004270911.1 acetate/propionate family kinase -
  A4W75_RS05670 (A4W75_05485) - 1091106..1092116 (-) 1011 WP_054644024.1 class I SAM-dependent methyltransferase -
  A4W75_RS05675 (A4W75_05490) - 1092241..1092564 (-) 324 WP_039099486.1 hypothetical protein -
  A4W75_RS05680 (A4W75_05495) - 1092542..1092922 (-) 381 WP_004270914.1 ComGF family competence protein -
  A4W75_RS11010 - 1092944..1093027 (-) 84 Protein_1128 type II secretion system protein -
  A4W75_RS05685 (A4W75_05500) - 1092993..1093298 (-) 306 WP_056965894.1 hypothetical protein -
  A4W75_RS05690 (A4W75_05505) - 1093285..1093644 (-) 360 WP_158022155.1 hypothetical protein -
  A4W75_RS05695 (A4W75_05510) comGC 1093709..1094017 (-) 309 WP_004270901.1 competence type IV pilus major pilin ComGC Machinery gene
  A4W75_RS05700 (A4W75_05515) comGB 1094014..1095015 (-) 1002 WP_004270906.1 type II secretion system F family protein Machinery gene
  A4W75_RS05705 (A4W75_05520) comGA 1095005..1095724 (-) 720 WP_253732251.1 ATPase, T2SS/T4P/T4SS family Machinery gene
  A4W75_RS05710 (A4W75_05530) - 1095983..1096714 (-) 732 WP_004270897.1 YebC/PmpR family DNA-binding transcriptional regulator -
  A4W75_RS05715 (A4W75_05535) - 1096804..1097304 (-) 501 WP_004270893.1 VanZ family protein -
  A4W75_RS05720 (A4W75_05540) - 1097407..1097784 (+) 378 WP_111447553.1 hypothetical protein -
  A4W75_RS05730 (A4W75_05550) - 1097965..1098300 (-) 336 WP_136903898.1 hypothetical protein -
  A4W75_RS05735 (A4W75_05555) - 1098495..1098734 (+) 240 WP_004270892.1 cytochrome b5 domain-containing protein -

Sequence


Protein


Download         Length: 102 a.a.        Molecular weight: 11238.13 Da        Isoelectric Point: 9.6264

>NTDB_id=188452 A4W75_RS05695 WP_004270901.1 1093709..1094017(-) (comGC) [Latilactobacillus curvatus strain TMW 1.27]
MKKKRNAFTLIEMVVVLAVIAMLVLLIAPNLMHQKETAEQKTDTALVATIQTQVELAEDDGKTVSSLADLASGEKYLTNN
QVKQAEKRGITIKDNKVVQNTK

Nucleotide


Download         Length: 309 bp        

>NTDB_id=188452 A4W75_RS05695 WP_004270901.1 1093709..1094017(-) (comGC) [Latilactobacillus curvatus strain TMW 1.27]
ATGAAGAAGAAAAGAAATGCATTTACATTGATCGAAATGGTCGTTGTGCTAGCTGTGATAGCAATGTTAGTCTTGTTAAT
TGCACCTAATTTAATGCATCAGAAAGAGACAGCTGAGCAAAAAACGGATACGGCTCTAGTGGCAACGATTCAAACACAAG
TTGAATTAGCTGAGGATGACGGTAAAACGGTGTCGAGTCTAGCCGATTTAGCATCAGGTGAAAAATATTTAACCAATAAT
CAGGTTAAACAAGCTGAAAAACGCGGCATAACAATTAAGGATAATAAAGTTGTTCAAAATACAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

60

98.039

0.588


Multiple sequence alignment