Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BBJ33_RS12115 Genome accession   NZ_CP016395
Coordinates   2543880..2544257 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain M75     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2538880..2549257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BBJ33_RS12075 (BBJ33_12075) - 2539379..2540173 (+) 795 WP_069473503.1 YqhG family protein -
  BBJ33_RS12080 (BBJ33_12080) sinI 2540350..2540523 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BBJ33_RS12085 (BBJ33_12085) sinR 2540557..2540892 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BBJ33_RS12090 (BBJ33_12090) tasA 2540940..2541725 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  BBJ33_RS12095 (BBJ33_12095) sipW 2541789..2542373 (-) 585 WP_003153100.1 signal peptidase I SipW -
  BBJ33_RS12100 (BBJ33_12100) tapA 2542345..2543016 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  BBJ33_RS12105 (BBJ33_12105) - 2543275..2543604 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  BBJ33_RS12110 (BBJ33_12110) - 2543644..2543823 (-) 180 WP_003153093.1 YqzE family protein -
  BBJ33_RS12115 (BBJ33_12115) comGG 2543880..2544257 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  BBJ33_RS12120 (BBJ33_12120) comGF 2544258..2544653 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  BBJ33_RS12125 (BBJ33_12125) comGE 2544667..2544981 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  BBJ33_RS12130 (BBJ33_12130) comGD 2544965..2545402 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  BBJ33_RS12135 (BBJ33_12135) comGC 2545392..2545700 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  BBJ33_RS12140 (BBJ33_12140) comGB 2545705..2546742 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  BBJ33_RS12145 (BBJ33_12145) comGA 2546729..2547799 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BBJ33_RS12150 (BBJ33_12150) - 2547991..2548941 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=187914 BBJ33_RS12115 WP_003153092.1 2543880..2544257(-) (comGG) [Bacillus velezensis strain M75]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=187914 BBJ33_RS12115 WP_003153092.1 2543880..2544257(-) (comGG) [Bacillus velezensis strain M75]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment