Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BBJ33_RS12080 | Genome accession | NZ_CP016395 |
| Coordinates | 2540350..2540523 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain M75 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2535350..2545523
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBJ33_RS12065 (BBJ33_12065) | gcvT | 2536168..2537268 (-) | 1101 | WP_069473502.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BBJ33_RS12070 (BBJ33_12070) | - | 2537691..2539361 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| BBJ33_RS12075 (BBJ33_12075) | - | 2539379..2540173 (+) | 795 | WP_069473503.1 | YqhG family protein | - |
| BBJ33_RS12080 (BBJ33_12080) | sinI | 2540350..2540523 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BBJ33_RS12085 (BBJ33_12085) | sinR | 2540557..2540892 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BBJ33_RS12090 (BBJ33_12090) | tasA | 2540940..2541725 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| BBJ33_RS12095 (BBJ33_12095) | sipW | 2541789..2542373 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| BBJ33_RS12100 (BBJ33_12100) | tapA | 2542345..2543016 (-) | 672 | WP_046341384.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BBJ33_RS12105 (BBJ33_12105) | - | 2543275..2543604 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| BBJ33_RS12110 (BBJ33_12110) | - | 2543644..2543823 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BBJ33_RS12115 (BBJ33_12115) | comGG | 2543880..2544257 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BBJ33_RS12120 (BBJ33_12120) | comGF | 2544258..2544653 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| BBJ33_RS12125 (BBJ33_12125) | comGE | 2544667..2544981 (-) | 315 | WP_046341385.1 | competence type IV pilus minor pilin ComGE | - |
| BBJ33_RS12130 (BBJ33_12130) | comGD | 2544965..2545402 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=187912 BBJ33_RS12080 WP_003153105.1 2540350..2540523(+) (sinI) [Bacillus velezensis strain M75]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=187912 BBJ33_RS12080 WP_003153105.1 2540350..2540523(+) (sinI) [Bacillus velezensis strain M75]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |