Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | A9Y60_RS02975 | Genome accession | NZ_CP016016 |
| Coordinates | 564603..565076 (+) | Length | 157 a.a. |
| NCBI ID | WP_012503482.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 34530 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 550049..603431 | 564603..565076 | within | 0 |
Gene organization within MGE regions
Location: 550049..603431
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9Y60_RS02900 (A9Y60_02900) | - | 550049..551032 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| A9Y60_RS02905 (A9Y60_02905) | - | 551099..551671 (+) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| A9Y60_RS02910 (A9Y60_02910) | - | 551797..552966 (-) | 1170 | WP_003690889.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| A9Y60_RS02915 (A9Y60_02915) | ilvA | 553115..554641 (+) | 1527 | WP_003690890.1 | threonine ammonia-lyase, biosynthetic | - |
| A9Y60_RS02920 (A9Y60_02920) | - | 554697..555773 (-) | 1077 | WP_003687905.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| A9Y60_RS13890 | - | 555796..555930 (-) | 135 | Protein_550 | IS5/IS1182 family transposase | - |
| A9Y60_RS02925 (A9Y60_02925) | cysW | 555914..556735 (-) | 822 | WP_012503473.1 | sulfate ABC transporter permease subunit CysW | - |
| A9Y60_RS02930 (A9Y60_02930) | cysT | 556924..557753 (-) | 830 | Protein_552 | sulfate ABC transporter permease subunit CysT | - |
| A9Y60_RS02935 (A9Y60_02935) | - | 557939..558271 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| A9Y60_RS02940 (A9Y60_02940) | - | 558601..559110 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| A9Y60_RS02945 (A9Y60_02945) | - | 559342..559923 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| A9Y60_RS02950 (A9Y60_02950) | dnaB | 560087..561490 (+) | 1404 | WP_012503477.1 | replicative DNA helicase | - |
| A9Y60_RS15535 | - | 561484..561596 (-) | 113 | Protein_557 | IS5/IS1182 family transposase | - |
| A9Y60_RS02955 (A9Y60_02955) | pilH | 561747..562409 (+) | 663 | WP_047916986.1 | GspH/FimT family pseudopilin | Machinery gene |
| A9Y60_RS02960 (A9Y60_02960) | pilI | 562441..563055 (+) | 615 | WP_012503479.1 | type IV pilus modification protein PilV | Machinery gene |
| A9Y60_RS02965 (A9Y60_02965) | pilJ | 563052..564014 (+) | 963 | WP_047921846.1 | PilW family protein | Machinery gene |
| A9Y60_RS02970 (A9Y60_02970) | pilK | 563993..564601 (+) | 609 | WP_047921847.1 | pilus assembly PilX family protein | Machinery gene |
| A9Y60_RS02975 (A9Y60_02975) | pilL | 564603..565076 (+) | 474 | WP_012503482.1 | PilX family type IV pilin | Machinery gene |
| A9Y60_RS02980 (A9Y60_02980) | - | 565146..565454 (-) | 309 | WP_003706588.1 | AzlD family protein | - |
| A9Y60_RS02985 (A9Y60_02985) | - | 565451..566162 (-) | 712 | Protein_564 | AzlC family ABC transporter permease | - |
| A9Y60_RS02990 (A9Y60_02990) | dut | 566328..566780 (+) | 453 | WP_003701071.1 | dUTP diphosphatase | - |
| A9Y60_RS02995 (A9Y60_02995) | dapC | 566852..568039 (+) | 1188 | WP_003701073.1 | succinyldiaminopimelate transaminase | - |
| A9Y60_RS03000 (A9Y60_03000) | yaaA | 568195..568974 (+) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| A9Y60_RS03015 (A9Y60_03015) | - | 569504..570704 (+) | 1201 | Protein_568 | tyrosine-type recombinase/integrase | - |
| A9Y60_RS03025 (A9Y60_03025) | - | 571060..571329 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| A9Y60_RS03030 (A9Y60_03030) | - | 571524..572207 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| A9Y60_RS15360 | - | 572488..572754 (-) | 267 | Protein_571 | hypothetical protein | - |
| A9Y60_RS03040 (A9Y60_03040) | - | 572865..573080 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| A9Y60_RS03045 (A9Y60_03045) | - | 573132..573623 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| A9Y60_RS03050 (A9Y60_03050) | - | 573620..573802 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| A9Y60_RS03055 (A9Y60_03055) | - | 573942..574628 (-) | 687 | WP_042758540.1 | phage replication initiation protein, NGO0469 family | - |
| A9Y60_RS03060 (A9Y60_03060) | - | 574697..574858 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| A9Y60_RS03065 (A9Y60_03065) | - | 574855..575130 (-) | 276 | WP_064661611.1 | NGO1622 family putative holin | - |
| A9Y60_RS03070 (A9Y60_03070) | - | 575283..575615 (-) | 333 | WP_003705604.1 | hypothetical protein | - |
| A9Y60_RS03075 (A9Y60_03075) | - | 575756..576043 (-) | 288 | WP_050171272.1 | hypothetical protein | - |
| A9Y60_RS03080 (A9Y60_03080) | - | 576040..576516 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| A9Y60_RS03085 (A9Y60_03085) | - | 576549..576749 (-) | 201 | WP_050156312.1 | hypothetical protein | - |
| A9Y60_RS03090 (A9Y60_03090) | - | 577233..577451 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| A9Y60_RS03095 (A9Y60_03095) | - | 577468..577827 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| A9Y60_RS03100 (A9Y60_03100) | - | 577828..578367 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| A9Y60_RS03105 (A9Y60_03105) | - | 578527..579243 (-) | 717 | WP_003695999.1 | XRE family transcriptional regulator | - |
| A9Y60_RS03110 (A9Y60_03110) | - | 579624..579851 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| A9Y60_RS03115 (A9Y60_03115) | - | 579969..581033 (+) | 1065 | WP_050154181.1 | hypothetical protein | - |
| A9Y60_RS03120 (A9Y60_03120) | - | 581030..582391 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| A9Y60_RS03125 (A9Y60_03125) | - | 582428..582691 (+) | 264 | WP_154235845.1 | hypothetical protein | - |
| A9Y60_RS03130 (A9Y60_03130) | - | 582730..583224 (+) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| A9Y60_RS03135 (A9Y60_03135) | - | 583401..583550 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| A9Y60_RS14835 | - | 583579..583860 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| A9Y60_RS03140 (A9Y60_03140) | - | 583851..584288 (+) | 438 | WP_017147288.1 | RusA family crossover junction endodeoxyribonuclease | - |
| A9Y60_RS03145 (A9Y60_03145) | - | 584281..584586 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| A9Y60_RS03150 (A9Y60_03150) | - | 584583..584966 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| A9Y60_RS03155 (A9Y60_03155) | - | 584957..585475 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| A9Y60_RS03160 (A9Y60_03160) | - | 585540..585962 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| A9Y60_RS14840 | - | 585962..586501 (+) | 540 | WP_229704488.1 | hypothetical protein | - |
| A9Y60_RS03175 (A9Y60_03175) | - | 586482..587756 (+) | 1275 | WP_003701186.1 | PBSX family phage terminase large subunit | - |
| A9Y60_RS03180 (A9Y60_03180) | - | 587741..590008 (+) | 2268 | WP_229689248.1 | hypothetical protein | - |
| A9Y60_RS03185 (A9Y60_03185) | - | 590245..591441 (+) | 1197 | WP_003687992.1 | hypothetical protein | - |
| A9Y60_RS03190 (A9Y60_03190) | - | 591438..592877 (+) | 1440 | WP_050153730.1 | hypothetical protein | - |
| A9Y60_RS15540 (A9Y60_03195) | - | 592877..598786 (+) | 5910 | WP_033909227.1 | PLxRFG domain-containing protein | - |
| A9Y60_RS03205 (A9Y60_03205) | - | 599412..600707 (+) | 1296 | WP_003690933.1 | DUF4043 family protein | - |
| A9Y60_RS03210 (A9Y60_03210) | - | 600762..601235 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| A9Y60_RS03215 (A9Y60_03215) | - | 601241..601726 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| A9Y60_RS03220 (A9Y60_03220) | - | 601723..602397 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| A9Y60_RS03225 (A9Y60_03225) | - | 602400..602549 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| A9Y60_RS03230 (A9Y60_03230) | - | 602586..603431 (-) | 846 | WP_047921371.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17486.30 Da Isoelectric Point: 9.9561
>NTDB_id=185177 A9Y60_RS02975 WP_012503482.1 564603..565076(+) (pilL) [Neisseria gonorrhoeae strain 34530]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=185177 A9Y60_RS02975 WP_012503482.1 564603..565076(+) (pilL) [Neisseria gonorrhoeae strain 34530]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.72 |
100 |
0.917 |
| pilX | Neisseria meningitidis 8013 |
85.35 |
100 |
0.854 |