Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLUL8_RS10010 | Genome accession | NZ_CP015908 |
| Coordinates | 1977254..1977805 (-) | Length | 183 a.a. |
| NCBI ID | WP_058221563.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain UL8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1940223..1990911 | 1977254..1977805 | within | 0 |
Gene organization within MGE regions
Location: 1940223..1990911
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUL8_RS09770 (LLUL8_1915) | macP | 1940223..1940501 (-) | 279 | WP_003130796.1 | cell wall synthase accessory phosphoprotein MacP | - |
| LLUL8_RS09775 (LLUL8_1916) | - | 1940494..1941078 (-) | 585 | WP_003130797.1 | NUDIX hydrolase | - |
| LLUL8_RS09780 (LLUL8_1917) | glmU | 1941183..1942559 (-) | 1377 | WP_003130798.1 | bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU | - |
| LLUL8_RS09785 (LLUL8_1918) | proC | 1942787..1943575 (+) | 789 | WP_012898440.1 | pyrroline-5-carboxylate reductase | - |
| LLUL8_RS09790 (LLUL8_1919) | rpsO | 1943654..1943923 (-) | 270 | WP_010906184.1 | 30S ribosomal protein S15 | - |
| LLUL8_RS09795 (LLUL8_1920) | pknB | 1944105..1945988 (-) | 1884 | WP_058221661.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| LLUL8_RS09800 (LLUL8_1921) | - | 1945988..1946764 (-) | 777 | WP_003130802.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| LLUL8_RS09805 (LLUL8_1922) | rsmB | 1946845..1948119 (-) | 1275 | WP_014570715.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| LLUL8_RS09820 (LLUL8_1923) | - | 1949249..1949977 (-) | 729 | WP_228763253.1 | Abi family protein | - |
| LLUL8_RS09825 (LLUL8_1924) | - | 1950159..1950938 (-) | 780 | WP_082225246.1 | peptidoglycan amidohydrolase family protein | - |
| LLUL8_RS09830 (LLUL8_1925) | - | 1950938..1951237 (-) | 300 | WP_082225247.1 | phage holin | - |
| LLUL8_RS09835 (LLUL8_1926) | - | 1951250..1951600 (-) | 351 | WP_082225248.1 | hypothetical protein | - |
| LLUL8_RS09840 (LLUL8_1927) | - | 1951613..1951849 (-) | 237 | WP_082225230.1 | hypothetical protein | - |
| LLUL8_RS12770 (LLUL8_1928) | - | 1951861..1956213 (-) | 4353 | WP_145952585.1 | hypothetical protein | - |
| LLUL8_RS09855 (LLUL8_1929) | - | 1956213..1957757 (-) | 1545 | WP_082225249.1 | distal tail protein Dit | - |
| LLUL8_RS09860 (LLUL8_1930) | - | 1957760..1961527 (-) | 3768 | WP_237024039.1 | tape measure protein | - |
| LLUL8_RS13315 | - | 1961734..1961841 (-) | 108 | WP_338141557.1 | phage tail tube assembly chaperone | - |
| LLUL8_RS13320 | - | 1961910..1962134 (-) | 225 | Protein_1910 | phage tail tube assembly chaperone | - |
| LLUL8_RS13185 (LLUL8_1932) | - | 1962201..1962428 (-) | 228 | WP_338141558.1 | phage tail protein | - |
| LLUL8_RS13190 (LLUL8_1933) | - | 1962403..1962711 (-) | 309 | WP_237024041.1 | phage tail protein | - |
| LLUL8_RS09875 (LLUL8_1934) | - | 1962753..1963148 (-) | 396 | WP_010905383.1 | DUF806 family protein | - |
| LLUL8_RS09880 (LLUL8_1935) | - | 1963145..1963627 (-) | 483 | WP_021214764.1 | HK97 gp10 family phage protein | - |
| LLUL8_RS09885 (LLUL8_1936) | - | 1963627..1963962 (-) | 336 | WP_010905381.1 | phage head closure protein | - |
| LLUL8_RS09890 (LLUL8_1937) | - | 1963949..1964254 (-) | 306 | WP_010905380.1 | head-tail connector protein | - |
| LLUL8_RS09895 (LLUL8_1938) | - | 1964265..1965578 (-) | 1314 | WP_058221420.1 | phage major capsid protein | - |
| LLUL8_RS09900 (LLUL8_1939) | - | 1965568..1966146 (-) | 579 | WP_306472235.1 | HK97 family phage prohead protease | - |
| LLUL8_RS09905 (LLUL8_1940) | - | 1966155..1967234 (-) | 1080 | WP_082225251.1 | phage portal protein | - |
| LLUL8_RS13000 (LLUL8_1941) | - | 1967231..1967395 (-) | 165 | WP_058221580.1 | hypothetical protein | - |
| LLUL8_RS09915 (LLUL8_1942) | - | 1967404..1969218 (-) | 1815 | WP_082225252.1 | terminase large subunit | - |
| LLUL8_RS09920 (LLUL8_1943) | - | 1969218..1969613 (-) | 396 | WP_047687184.1 | phage terminase small subunit P27 family | - |
| LLUL8_RS09925 (LLUL8_1944) | - | 1969770..1970273 (-) | 504 | WP_058221813.1 | HNH endonuclease | - |
| LLUL8_RS12775 (LLUL8_1945) | - | 1970279..1970515 (-) | 237 | WP_058221812.1 | hypothetical protein | - |
| LLUL8_RS09935 (LLUL8_1946) | - | 1970804..1971226 (-) | 423 | WP_032398555.1 | RinA family protein | - |
| LLUL8_RS13005 (LLUL8_1947) | - | 1971751..1971906 (-) | 156 | WP_043991164.1 | hypothetical protein | - |
| LLUL8_RS09945 (LLUL8_1948) | - | 1971903..1972088 (-) | 186 | WP_014570738.1 | hypothetical protein | - |
| LLUL8_RS09950 (LLUL8_1949) | - | 1972096..1972299 (-) | 204 | WP_014570739.1 | hypothetical protein | - |
| LLUL8_RS09955 | - | 1972422..1972598 (-) | 177 | WP_043991165.1 | DUF1660 domain-containing protein | - |
| LLUL8_RS09960 (LLUL8_1950) | - | 1972595..1972813 (-) | 219 | WP_011834792.1 | hypothetical protein | - |
| LLUL8_RS09965 (LLUL8_1951) | - | 1972860..1973105 (-) | 246 | WP_058221649.1 | hypothetical protein | - |
| LLUL8_RS12850 (LLUL8_1952) | - | 1973127..1973276 (-) | 150 | WP_153927798.1 | hypothetical protein | - |
| LLUL8_RS09970 (LLUL8_1953) | - | 1973273..1973947 (-) | 675 | WP_082225253.1 | DUF1642 domain-containing protein | - |
| LLUL8_RS09975 (LLUL8_1954) | - | 1973940..1974146 (-) | 207 | WP_011676933.1 | DUF1125 domain-containing protein | - |
| LLUL8_RS09980 (LLUL8_1955) | - | 1974160..1974684 (-) | 525 | WP_011834787.1 | hypothetical protein | - |
| LLUL8_RS09985 | - | 1974793..1975032 (-) | 240 | WP_014570744.1 | DUF1031 family protein | - |
| LLUL8_RS09990 (LLUL8_1956) | - | 1975025..1975219 (-) | 195 | WP_014570745.1 | hypothetical protein | - |
| LLUL8_RS09995 (LLUL8_1957) | - | 1975222..1975611 (-) | 390 | WP_082225254.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLUL8_RS10000 (LLUL8_1958) | - | 1975608..1976333 (-) | 726 | WP_058221565.1 | hypothetical protein | - |
| LLUL8_RS10005 (LLUL8_1959) | - | 1976333..1977121 (-) | 789 | WP_058221564.1 | phage replisome organiser protein | - |
| LLUL8_RS10010 (LLUL8_1960) | ssb | 1977254..1977805 (-) | 552 | WP_058221563.1 | single-stranded DNA-binding protein | Machinery gene |
| LLUL8_RS10015 (LLUL8_1961) | - | 1977819..1978310 (-) | 492 | WP_050499054.1 | ERF family protein | - |
| LLUL8_RS10020 (LLUL8_1962) | - | 1978319..1978708 (-) | 390 | WP_058221562.1 | hypothetical protein | - |
| LLUL8_RS10025 (LLUL8_1963) | - | 1978710..1979042 (-) | 333 | WP_032398920.1 | helix-turn-helix domain-containing protein | - |
| LLUL8_RS10030 (LLUL8_1964) | - | 1979039..1979275 (-) | 237 | WP_050499055.1 | helix-turn-helix transcriptional regulator | - |
| LLUL8_RS10035 (LLUL8_1965) | - | 1979375..1979611 (-) | 237 | WP_032398921.1 | DUF1408 domain-containing protein | - |
| LLUL8_RS10040 (LLUL8_1966) | - | 1979714..1980064 (+) | 351 | WP_032398922.1 | hypothetical protein | - |
| LLUL8_RS10045 (LLUL8_1968) | - | 1980216..1980449 (-) | 234 | WP_011834776.1 | hypothetical protein | - |
| LLUL8_RS10050 (LLUL8_1969) | - | 1980543..1980812 (-) | 270 | WP_011835841.1 | hypothetical protein | - |
| LLUL8_RS10055 (LLUL8_1970) | - | 1980826..1981575 (-) | 750 | WP_058221874.1 | phage antirepressor KilAC domain-containing protein | - |
| LLUL8_RS10060 (LLUL8_1971) | - | 1981587..1981817 (-) | 231 | WP_042749062.1 | hypothetical protein | - |
| LLUL8_RS10065 (LLUL8_1972) | - | 1981922..1982188 (+) | 267 | WP_015966961.1 | hypothetical protein | - |
| LLUL8_RS10070 (LLUL8_1973) | - | 1982182..1982376 (-) | 195 | WP_032398925.1 | hypothetical protein | - |
| LLUL8_RS12855 (LLUL8_1974) | - | 1982416..1982625 (-) | 210 | WP_023164539.1 | hypothetical protein | - |
| LLUL8_RS10080 (LLUL8_1975) | - | 1982779..1983156 (+) | 378 | WP_058221873.1 | hypothetical protein | - |
| LLUL8_RS10085 (LLUL8_1976) | - | 1983149..1983415 (+) | 267 | WP_058221872.1 | hypothetical protein | - |
| LLUL8_RS10090 (LLUL8_1978) | - | 1983584..1983781 (-) | 198 | WP_014735140.1 | hypothetical protein | - |
| LLUL8_RS10095 (LLUL8_1979) | - | 1984011..1984547 (+) | 537 | WP_058221871.1 | helix-turn-helix domain-containing protein | - |
| LLUL8_RS10100 (LLUL8_1980) | - | 1984553..1984987 (+) | 435 | WP_023164542.1 | zinc peptidase | - |
| LLUL8_RS10105 (LLUL8_1981) | - | 1985001..1985336 (+) | 336 | WP_058221870.1 | hypothetical protein | - |
| LLUL8_RS10110 (LLUL8_1982) | - | 1985404..1986585 (+) | 1182 | WP_058221869.1 | site-specific integrase | - |
| LLUL8_RS10115 (LLUL8_1983) | - | 1986886..1987392 (-) | 507 | WP_003131479.1 | Asp23/Gls24 family envelope stress response protein | - |
| LLUL8_RS10120 (LLUL8_1984) | - | 1987413..1987601 (-) | 189 | WP_012898445.1 | DUF2273 domain-containing protein | - |
| LLUL8_RS10125 (LLUL8_1985) | amaP | 1987612..1988172 (-) | 561 | WP_010906186.1 | alkaline shock response membrane anchor protein AmaP | - |
| LLUL8_RS10130 (LLUL8_1986) | - | 1988200..1988442 (-) | 243 | WP_003131476.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| LLUL8_RS10140 (LLUL8_1987) | fmt | 1988617..1989576 (-) | 960 | WP_010906187.1 | methionyl-tRNA formyltransferase | - |
| LLUL8_RS10145 (LLUL8_1988) | - | 1989573..1990037 (-) | 465 | WP_003131474.1 | VOC family protein | - |
| LLUL8_RS10150 (LLUL8_1989) | - | 1990003..1990524 (-) | 522 | WP_003131472.1 | NUDIX hydrolase | - |
| LLUL8_RS10155 (LLUL8_1990) | - | 1990537..1990911 (-) | 375 | WP_014570768.1 | nuclear transport factor 2 family protein | - |
Sequence
Protein
Download Length: 183 a.a. Molecular weight: 20998.76 Da Isoelectric Point: 6.4657
>NTDB_id=183374 LLUL8_RS10010 WP_058221563.1 1977254..1977805(-) (ssb) [Lactococcus lactis subsp. lactis strain UL8]
MINNVVLVGRLTKDVELRYTPQNQATATFSLAVSRSFKNANGERETDFINCVIWRQQAENMANFTHKGSLIGITGRIQTR
NYENQQGQRVYVTEVVADSFQLLESRSQGQQQQQQGNYNQNQNNYQNQGQQNTVQQQHNQGNYQRQPQGNYQNQQQSAQQ
RAQQPDPNFGGAPMEINDEDLPF
MINNVVLVGRLTKDVELRYTPQNQATATFSLAVSRSFKNANGERETDFINCVIWRQQAENMANFTHKGSLIGITGRIQTR
NYENQQGQRVYVTEVVADSFQLLESRSQGQQQQQQGNYNQNQNNYQNQGQQNTVQQQHNQGNYQRQPQGNYQNQQQSAQQ
RAQQPDPNFGGAPMEINDEDLPF
Nucleotide
Download Length: 552 bp
>NTDB_id=183374 LLUL8_RS10010 WP_058221563.1 1977254..1977805(-) (ssb) [Lactococcus lactis subsp. lactis strain UL8]
ATGATAAATAACGTAGTTTTAGTCGGAAGACTAACTAAAGATGTAGAACTTAGATATACTCCACAAAATCAAGCTACAGC
AACTTTCTCGCTTGCAGTGAGTCGCTCTTTCAAAAATGCCAATGGAGAACGTGAAACAGATTTTATTAACTGTGTTATCT
GGCGACAACAAGCTGAAAATATGGCAAATTTCACACATAAAGGAAGCTTGATTGGTATCACTGGTAGAATCCAAACTCGA
AACTATGAAAATCAACAAGGACAACGTGTTTACGTTACTGAAGTTGTTGCAGATAGTTTCCAACTTCTTGAAAGTAGAAG
CCAAGGTCAACAACAGCAACAACAAGGAAATTACAATCAAAACCAAAATAATTACCAAAATCAGGGTCAACAAAATACTG
TTCAACAGCAACATAACCAAGGTAACTACCAAAGACAACCTCAAGGTAATTATCAAAATCAACAACAATCAGCTCAACAA
AGAGCCCAACAACCTGATCCAAACTTTGGAGGTGCTCCGATGGAAATCAACGATGAAGACCTACCATTCTAA
ATGATAAATAACGTAGTTTTAGTCGGAAGACTAACTAAAGATGTAGAACTTAGATATACTCCACAAAATCAAGCTACAGC
AACTTTCTCGCTTGCAGTGAGTCGCTCTTTCAAAAATGCCAATGGAGAACGTGAAACAGATTTTATTAACTGTGTTATCT
GGCGACAACAAGCTGAAAATATGGCAAATTTCACACATAAAGGAAGCTTGATTGGTATCACTGGTAGAATCCAAACTCGA
AACTATGAAAATCAACAAGGACAACGTGTTTACGTTACTGAAGTTGTTGCAGATAGTTTCCAACTTCTTGAAAGTAGAAG
CCAAGGTCAACAACAGCAACAACAAGGAAATTACAATCAAAACCAAAATAATTACCAAAATCAGGGTCAACAAAATACTG
TTCAACAGCAACATAACCAAGGTAACTACCAAAGACAACCTCAAGGTAATTATCAAAATCAACAACAATCAGCTCAACAA
AGAGCCCAACAACCTGATCCAAACTTTGGAGGTGCTCCGATGGAAATCAACGATGAAGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.851 |
100 |
0.574 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.514 |
100 |
0.541 |
| ssb | Glaesserella parasuis strain SC1401 |
34.555 |
100 |
0.361 |