Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LLJM2_RS11195 | Genome accession | NZ_CP015900 |
| Coordinates | 2166755..2166982 (-) | Length | 75 a.a. |
| NCBI ID | WP_228764408.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain JM2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2162146..2170376 | 2166755..2166982 | within | 0 |
Gene organization within MGE regions
Location: 2162146..2170376
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLJM2_RS11175 (LLJM2_2193) | - | 2163681..2164490 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLJM2_RS11180 (LLJM2_2194) | - | 2164483..2165220 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLJM2_RS11185 (LLJM2_2195) | - | 2165399..2166241 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLJM2_RS11190 (LLJM2_2196) | - | 2166238..2166675 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLJM2_RS11195 (LLJM2_03575) | comGG | 2166755..2166982 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLJM2_RS11200 (LLJM2_2198) | comGF | 2167078..2167503 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLJM2_RS11205 (LLJM2_2199) | comGE | 2167487..2167723 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLJM2_RS11210 (LLJM2_2200) | comGD | 2167755..2167943 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLJM2_RS11215 (LLJM2_2201) | comGC | 2168145..2168522 (-) | 378 | Protein_2171 | competence type IV pilus major pilin ComGC | - |
| LLJM2_RS11220 (LLJM2_2202) | comGB | 2168540..2169565 (-) | 1026 | WP_050574185.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
Sequence
Protein
Download Length: 75 a.a. Molecular weight: 8406.73 Da Isoelectric Point: 9.0864
>NTDB_id=182995 LLJM2_RS11195 WP_228764408.1 2166755..2166982(-) (comGG) [Lactococcus cremoris strain JM2]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK
Nucleotide
Download Length: 228 bp
>NTDB_id=182995 LLJM2_RS11195 WP_228764408.1 2166755..2166982(-) (comGG) [Lactococcus cremoris strain JM2]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
96 |
100 |
0.96 |