Detailed information NTG0180538

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: A2I63_RS06745
• Genome accession: NZ_CP015536
• Coordinates: 1386424..1386750 (+)
• Length: 108 a.a.
• NCBI ID: WP_015900413.1
• Uniprot ID: -
• Organism: Staphylococcus carnosus strain TMW 2.243
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1381424..1391750

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A2I63_RS06715 (A2I63_06585)	-	1382178..1382378 (+)	201	WP_015900419.1	YqgQ family protein	-
A2I63_RS06720 (A2I63_06590)	-	1382378..1383364 (+)	987	WP_015900418.1	ROK family glucokinase	-
A2I63_RS06725 (A2I63_06595)	-	1383364..1383693 (+)	330	WP_015900417.1	MTH1187 family thiamine-binding protein	-
A2I63_RS06730 (A2I63_06600)	-	1383693..1384316 (+)	624	WP_015900416.1	MBL fold metallo-hydrolase	-
A2I63_RS06735 (A2I63_06605)	comGA	1384387..1385361 (+)	975	WP_015900415.1	competence type IV pilus ATPase ComGA	Machinery gene
A2I63_RS06740 (A2I63_06610)	comGB	1385333..1386406 (+)	1074	WP_015900414.1	competence type IV pilus assembly protein ComGB	-
A2I63_RS06745 (A2I63_06615)	comGC	1386424..1386750 (+)	327	WP_015900413.1	competence type IV pilus major pilin ComGC	Machinery gene
A2I63_RS06750 (A2I63_06620)	-	1386770..1387183 (+)	414	WP_231635362.1	prepilin-type cleavage/methylation domain-containing protein	-
A2I63_RS06755 (A2I63_06625)	-	1387164..1387460 (+)	297	WP_041612977.1	hypothetical protein	-
A2I63_RS06760 (A2I63_06630)	comGF	1387417..1387875 (+)	459	WP_158297486.1	competence type IV pilus minor pilin ComGF	-
A2I63_RS06765 (A2I63_06635)	-	1388046..1388585 (+)	540	WP_015900411.1	shikimate kinase	-
A2I63_RS06770 (A2I63_06640)	gcvT	1388776..1389870 (+)	1095	WP_015900410.1	glycine cleavage system aminomethyltransferase GcvT	-
A2I63_RS06775 (A2I63_06645)	gcvPA	1389891..1391237 (+)	1347	WP_015900409.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12186.36 Da
• Isoelectric Point: 9.8933

>NTDB_id=180538 A2I63_RS06745 WP_015900413.1 1386424..1386750(+) (comGC) [Staphylococcus carnosus strain TMW 2.243]
MKRYYFKLKNKNLKAFTLLEMLLVLLVISVLLILIIPNIAKQSEHVQATGCEAQQKMVNSQIEAYSLKNNRKPDSIDELV
TQGYLKEAQKKCKSGESITIKNGEASIS

Nucleotide

• Length: 327 bp

>NTDB_id=180538 A2I63_RS06745 WP_015900413.1 1386424..1386750(+) (comGC) [Staphylococcus carnosus strain TMW 2.243]
ATGAAAAGATATTACTTTAAATTGAAAAATAAAAACTTAAAAGCTTTTACATTGTTAGAAATGCTGCTTGTATTATTGGT
TATTAGTGTATTATTAATTTTAATTATACCGAATATCGCTAAACAATCTGAACATGTCCAGGCTACAGGTTGTGAGGCAC
AACAAAAAATGGTGAATAGTCAAATAGAAGCTTATTCACTTAAAAATAATAGAAAACCTGATAGTATTGATGAACTTGTT
ACACAAGGATATTTAAAAGAAGCTCAAAAGAAGTGTAAATCAGGAGAAAGTATAACAATAAAAAATGGTGAAGCATCAAT
TAGCTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-35)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	72.632	87.963	0.639
comGC	Staphylococcus aureus N315	72.632	87.963	0.639
comGC/cglC	Streptococcus mitis SK321	45.283	98.148	0.444
comGC/cglC	Streptococcus pneumoniae R6	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae D39	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae TIGR4	44.34	98.148	0.435
comGC/cglC	Streptococcus pneumoniae Rx1	44.34	98.148	0.435
comGC/cglC	Streptococcus mitis NCTC 12261	47.826	85.185	0.407
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	76.852	0.38
comGC	Bacillus subtilis subsp. subtilis str. 168	40.625	88.889	0.361