Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AS891_RS10810 | Genome accession | NZ_CP015375 |
| Coordinates | 2059596..2059769 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain KCTC 3135 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2054596..2064769
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AS891_RS10765 (AS891_10760) | comGE | 2054871..2055218 (+) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
| AS891_RS10770 (AS891_10765) | comGF | 2055244..2055627 (+) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| AS891_RS10775 (AS891_10770) | comGG | 2055628..2056002 (+) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| AS891_RS10780 (AS891_10775) | spoIITA | 2056073..2056252 (+) | 180 | WP_003230176.1 | YqzE family protein | - |
| AS891_RS10785 (AS891_10780) | yqzG | 2056294..2056620 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| AS891_RS10790 (AS891_10785) | tapA | 2056892..2057653 (+) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AS891_RS10795 (AS891_10790) | sipW | 2057637..2058209 (+) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| AS891_RS10800 (AS891_10795) | tasA | 2058273..2059058 (+) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| AS891_RS10805 (AS891_10800) | sinR | 2059151..2059486 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AS891_RS10810 (AS891_10805) | sinI | 2059596..2059769 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| AS891_RS10815 (AS891_10810) | yqhG | 2059952..2060746 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| AS891_RS10820 (AS891_10815) | hepAA | 2060767..2062440 (-) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| AS891_RS10825 (AS891_10820) | gcvT | 2062882..2063970 (+) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=178921 AS891_RS10810 WP_003230187.1 2059596..2059769(-) (sinI) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=178921 AS891_RS10810 WP_003230187.1 2059596..2059769(-) (sinI) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |