Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AS891_RS10775 Genome accession   NZ_CP015375
Coordinates   2055628..2056002 (+) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis strain KCTC 3135     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2050628..2061002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AS891_RS10735 (AS891_10730) corA 2050697..2051650 (+) 954 WP_004399136.1 magnesium transporter CorA -
  AS891_RS10745 (AS891_10740) comGA 2052062..2053132 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AS891_RS10750 (AS891_10745) comGB 2053119..2054156 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  AS891_RS10755 (AS891_10750) comGC 2054170..2054466 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AS891_RS10760 (AS891_10755) comGD 2054456..2054887 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  AS891_RS10765 (AS891_10760) comGE 2054871..2055218 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AS891_RS10770 (AS891_10765) comGF 2055244..2055627 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  AS891_RS10775 (AS891_10770) comGG 2055628..2056002 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  AS891_RS10780 (AS891_10775) spoIITA 2056073..2056252 (+) 180 WP_003230176.1 YqzE family protein -
  AS891_RS10785 (AS891_10780) yqzG 2056294..2056620 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AS891_RS10790 (AS891_10785) tapA 2056892..2057653 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  AS891_RS10795 (AS891_10790) sipW 2057637..2058209 (+) 573 WP_003246088.1 signal peptidase I SipW -
  AS891_RS10800 (AS891_10795) tasA 2058273..2059058 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  AS891_RS10805 (AS891_10800) sinR 2059151..2059486 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AS891_RS10810 (AS891_10805) sinI 2059596..2059769 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  AS891_RS10815 (AS891_10810) yqhG 2059952..2060746 (-) 795 WP_003230200.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=178919 AS891_RS10775 WP_003230170.1 2055628..2056002(+) (comGG) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=178919 AS891_RS10775 WP_003230170.1 2055628..2056002(+) (comGG) [Bacillus subtilis subsp. subtilis strain KCTC 3135]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment