Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   SporoP33_RS04675 Genome accession   NZ_CP015027
Coordinates   936992..937456 (-) Length   154 a.a.
NCBI ID   WP_081242656.1    Uniprot ID   -
Organism   Sporosarcina sp. P33     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 902069..944061 936992..937456 within 0


Gene organization within MGE regions


Location: 902069..944061
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SporoP33_RS04435 (SporoP33_04410) - 902069..903358 (+) 1290 WP_196796852.1 FtsK/SpoIIIE domain-containing protein -
  SporoP33_RS04440 (SporoP33_04415) - 903363..903902 (+) 540 WP_231293329.1 replication-relaxation family protein -
  SporoP33_RS04445 (SporoP33_04420) - 903916..904452 (+) 537 WP_081242614.1 hypothetical protein -
  SporoP33_RS04450 (SporoP33_04425) - 904633..905538 (-) 906 WP_081242615.1 M15 family metallopeptidase -
  SporoP33_RS04455 (SporoP33_04430) - 905538..905831 (-) 294 WP_081242616.1 phage holin -
  SporoP33_RS04460 (SporoP33_04435) - 905845..906252 (-) 408 WP_081242617.1 hypothetical protein -
  SporoP33_RS04465 (SporoP33_04440) - 906345..906527 (-) 183 WP_081242618.1 hypothetical protein -
  SporoP33_RS04470 (SporoP33_04445) - 906547..906777 (-) 231 WP_081242619.1 XkdX family protein -
  SporoP33_RS04475 (SporoP33_04450) - 906774..906986 (-) 213 WP_081242620.1 hypothetical protein -
  SporoP33_RS04480 (SporoP33_04455) - 907000..909444 (-) 2445 WP_081242621.1 DUF6273 domain-containing protein -
  SporoP33_RS04485 (SporoP33_04460) - 909449..910471 (-) 1023 WP_196796853.1 reverse transcriptase/maturase family protein -
  SporoP33_RS16555 - 910482..910703 (-) 222 WP_369821958.1 hypothetical protein -
  SporoP33_RS04490 (SporoP33_04465) - 910753..911121 (-) 369 WP_155961308.1 four helix bundle protein -
  SporoP33_RS04495 (SporoP33_04470) - 911163..911534 (-) 372 WP_081242623.1 hypothetical protein -
  SporoP33_RS04500 (SporoP33_04475) - 911527..911856 (-) 330 WP_081242624.1 hypothetical protein -
  SporoP33_RS04505 (SporoP33_04480) - 911856..912731 (-) 876 WP_081242625.1 phage tail protein -
  SporoP33_RS04510 (SporoP33_04485) - 912724..913836 (-) 1113 WP_081242626.1 baseplate J/gp47 family protein -
  SporoP33_RS04515 (SporoP33_04490) - 913833..914162 (-) 330 WP_081242627.1 hypothetical protein -
  SporoP33_RS04520 (SporoP33_04495) - 914159..914548 (-) 390 WP_081242628.1 phage tail protein -
  SporoP33_RS04525 (SporoP33_04500) - 914561..915052 (-) 492 WP_081242629.1 hypothetical protein -
  SporoP33_RS04530 (SporoP33_04505) - 915049..916059 (-) 1011 WP_196796854.1 phage late control D family protein -
  SporoP33_RS04535 (SporoP33_04510) - 916056..916262 (-) 207 WP_081242631.1 tail protein X -
  SporoP33_RS04540 (SporoP33_04515) - 916259..919774 (-) 3516 WP_081242632.1 phage tail tape measure protein -
  SporoP33_RS04545 (SporoP33_04520) - 919923..920282 (-) 360 WP_196796855.1 phage tail assembly protein -
  SporoP33_RS04550 (SporoP33_04525) - 920314..920835 (-) 522 WP_081242634.1 phage major tail tube protein -
  SporoP33_RS04555 (SporoP33_04530) - 920854..922275 (-) 1422 WP_081242635.1 phage tail protein -
  SporoP33_RS04560 (SporoP33_04535) - 922278..922646 (-) 369 WP_081242636.1 hypothetical protein -
  SporoP33_RS04565 (SporoP33_04540) - 922636..923136 (-) 501 WP_081242637.1 hypothetical protein -
  SporoP33_RS04570 (SporoP33_04545) - 923133..923729 (-) 597 WP_081242638.1 phage tail protein -
  SporoP33_RS04575 (SporoP33_04550) - 923726..924058 (-) 333 WP_081242639.1 hypothetical protein -
  SporoP33_RS04580 (SporoP33_04555) - 924055..924453 (-) 399 WP_081242640.1 hypothetical protein -
  SporoP33_RS04585 (SporoP33_04560) - 924467..925513 (-) 1047 WP_196796856.1 major capsid protein -
  SporoP33_RS04590 (SporoP33_04565) - 925517..925876 (-) 360 WP_081242641.1 hypothetical protein -
  SporoP33_RS04595 (SporoP33_04570) - 925873..927027 (-) 1155 WP_081242642.1 head maturation protease, ClpP-related -
  SporoP33_RS04600 (SporoP33_04575) - 927024..928595 (-) 1572 WP_081242643.1 phage portal protein -
  SporoP33_RS04605 (SporoP33_04580) - 928609..928851 (-) 243 WP_196796857.1 DUF6148 family protein -
  SporoP33_RS04610 (SporoP33_04585) - 928848..930617 (-) 1770 WP_196796858.1 phage terminase large subunit family protein -
  SporoP33_RS04615 (SporoP33_04590) - 930604..931158 (-) 555 WP_081242644.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
  SporoP33_RS04620 (SporoP33_04595) - 931670..932239 (-) 570 WP_081242645.1 tyrosine-type recombinase/integrase -
  SporoP33_RS04625 (SporoP33_04600) - 932236..932877 (-) 642 WP_231293330.1 LuxR C-terminal-related transcriptional regulator -
  SporoP33_RS04630 (SporoP33_04605) - 933013..933213 (-) 201 WP_081242647.1 hypothetical protein -
  SporoP33_RS04635 (SporoP33_04610) - 933249..933464 (-) 216 WP_081242648.1 hypothetical protein -
  SporoP33_RS04640 (SporoP33_04615) - 933642..933869 (-) 228 WP_081242649.1 hypothetical protein -
  SporoP33_RS04645 (SporoP33_04620) - 933866..934093 (-) 228 WP_081242650.1 hypothetical protein -
  SporoP33_RS04650 (SporoP33_04625) - 934086..934295 (-) 210 WP_081242651.1 hypothetical protein -
  SporoP33_RS04655 (SporoP33_04630) - 934288..935019 (-) 732 WP_081242652.1 hypothetical protein -
  SporoP33_RS04660 (SporoP33_04635) - 935053..935313 (-) 261 WP_081242653.1 hypothetical protein -
  SporoP33_RS04665 (SporoP33_04640) - 935409..935969 (-) 561 WP_081242654.1 dUTP diphosphatase -
  SporoP33_RS04670 (SporoP33_04645) - 936124..936969 (-) 846 WP_081242655.1 SANT/Myb-like DNA-binding domain-containing protein -
  SporoP33_RS04675 (SporoP33_04650) ssbA 936992..937456 (-) 465 WP_081242656.1 single-stranded DNA-binding protein Machinery gene
  SporoP33_RS16420 - 937477..937605 (-) 129 WP_255363024.1 hypothetical protein -
  SporoP33_RS04680 (SporoP33_04655) - 937598..937822 (-) 225 WP_081242657.1 hypothetical protein -
  SporoP33_RS15940 - 937837..938007 (-) 171 WP_155961309.1 hypothetical protein -
  SporoP33_RS04685 (SporoP33_04660) - 938020..938886 (-) 867 WP_081242658.1 ATP-binding protein -
  SporoP33_RS04690 (SporoP33_04665) - 938810..939652 (-) 843 WP_081242659.1 phage replisome organizer N-terminal domain-containing protein -
  SporoP33_RS04695 (SporoP33_04670) - 939762..940040 (-) 279 WP_081242660.1 hypothetical protein -
  SporoP33_RS04700 (SporoP33_04675) - 940041..940322 (-) 282 WP_081242661.1 hypothetical protein -
  SporoP33_RS04705 (SporoP33_04680) - 940431..940763 (-) 333 WP_081242662.1 hypothetical protein -
  SporoP33_RS04710 (SporoP33_04685) - 940760..941506 (-) 747 WP_081242663.1 phage regulatory protein/antirepressor Ant -
  SporoP33_RS04715 (SporoP33_04690) - 941503..941703 (-) 201 WP_081242664.1 helix-turn-helix transcriptional regulator -
  SporoP33_RS04720 (SporoP33_04695) - 941661..941930 (-) 270 WP_081242665.1 helix-turn-helix transcriptional regulator -
  SporoP33_RS04725 (SporoP33_04700) - 942076..942480 (+) 405 WP_081242666.1 helix-turn-helix transcriptional regulator -
  SporoP33_RS04730 (SporoP33_04705) - 942671..942829 (+) 159 WP_231293331.1 helix-turn-helix transcriptional regulator -
  SporoP33_RS04735 (SporoP33_04710) - 942991..944061 (+) 1071 WP_081242668.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 154 a.a.        Molecular weight: 17199.94 Da        Isoelectric Point: 9.3020

>NTDB_id=176242 SporoP33_RS04675 WP_081242656.1 936992..937456(-) (ssbA) [Sporosarcina sp. P33]
MINRVVLVGRLTKDPELKYTQAGIAVVRFTLAVNRAFSNNQGEREADFINCVAWRKQAENISNYLRKGSLAGVDGRIQTG
SFEDQDGKRVYTTEVVADSTQFLEPRNNAQQRSQQPQQQTQSNTQTNKYNSPGNYGGHSQQYAPPENSGGLPIY

Nucleotide


Download         Length: 465 bp        

>NTDB_id=176242 SporoP33_RS04675 WP_081242656.1 936992..937456(-) (ssbA) [Sporosarcina sp. P33]
ATGATAAATAGAGTTGTACTTGTCGGCAGGCTAACAAAAGACCCGGAGCTAAAATACACTCAAGCAGGAATTGCAGTCGT
TCGTTTCACTTTAGCGGTGAATAGAGCGTTCTCGAACAATCAAGGCGAACGCGAAGCAGACTTTATCAATTGTGTGGCAT
GGAGAAAACAAGCGGAGAATATTTCAAATTATCTTAGAAAAGGGAGTTTGGCAGGAGTGGATGGACGAATTCAAACAGGC
AGCTTTGAAGACCAGGACGGAAAGCGGGTGTATACGACAGAAGTTGTTGCAGACAGCACGCAGTTTTTGGAACCCCGTAA
TAATGCACAGCAAAGATCACAGCAACCTCAACAACAAACGCAATCCAATACTCAAACGAACAAATACAACAGCCCAGGCA
ATTACGGTGGACATTCTCAACAGTATGCACCGCCTGAAAACTCCGGCGGCTTACCAATCTACTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

71.963

69.481

0.5
  ssb Latilactobacillus sakei subsp. sakei 23K

50.658

98.701

0.5
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

68.831

0.416

Multiple sequence alignment