Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   A3772_RS17140 Genome accession   NZ_CP015004
Coordinates   3236687..3236827 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SZMC 6179J isolate B23     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3231687..3241827
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A3772_RS17115 (A3772_17115) yuxO 3232000..3232380 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  A3772_RS17120 (A3772_17120) comA 3232399..3233043 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  A3772_RS17125 (A3772_17125) comP 3233124..3235433 (-) 2310 WP_062826636.1 two-component system sensor histidine kinase ComP Regulator
  A3772_RS17130 (A3772_17130) comX 3235448..3235615 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  A3772_RS17135 (A3772_17135) comQ 3235603..3236502 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  A3772_RS17140 (A3772_17140) degQ 3236687..3236827 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  A3772_RS22850 - 3237049..3237174 (+) 126 WP_003228793.1 hypothetical protein -
  A3772_RS17145 (A3772_17145) - 3237288..3237656 (+) 369 WP_003243784.1 hypothetical protein -
  A3772_RS17150 (A3772_17150) pdeH 3237632..3238861 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  A3772_RS17155 (A3772_17155) pncB 3238998..3240470 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  A3772_RS17160 (A3772_17160) pncA 3240486..3241037 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  A3772_RS17165 (A3772_17165) yueI 3241134..3241532 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=176078 A3772_RS17140 WP_003220708.1 3236687..3236827(-) (degQ) [Bacillus subtilis strain SZMC 6179J isolate B23]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=176078 A3772_RS17140 WP_003220708.1 3236687..3236827(-) (degQ) [Bacillus subtilis strain SZMC 6179J isolate B23]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment