Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   A3772_RS17130 Genome accession   NZ_CP015004
Coordinates   3235448..3235615 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain SZMC 6179J isolate B23     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3230448..3240615
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A3772_RS17100 (A3772_17100) mrpE 3230843..3231319 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  A3772_RS17105 (A3772_17105) mrpF 3231319..3231603 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  A3772_RS17110 (A3772_17110) mnhG 3231587..3231961 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  A3772_RS17115 (A3772_17115) yuxO 3232000..3232380 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  A3772_RS17120 (A3772_17120) comA 3232399..3233043 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  A3772_RS17125 (A3772_17125) comP 3233124..3235433 (-) 2310 WP_062826636.1 two-component system sensor histidine kinase ComP Regulator
  A3772_RS17130 (A3772_17130) comX 3235448..3235615 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  A3772_RS17135 (A3772_17135) comQ 3235603..3236502 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  A3772_RS17140 (A3772_17140) degQ 3236687..3236827 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  A3772_RS22850 - 3237049..3237174 (+) 126 WP_003228793.1 hypothetical protein -
  A3772_RS17145 (A3772_17145) - 3237288..3237656 (+) 369 WP_003243784.1 hypothetical protein -
  A3772_RS17150 (A3772_17150) pdeH 3237632..3238861 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  A3772_RS17155 (A3772_17155) pncB 3238998..3240470 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=176076 A3772_RS17130 WP_003242801.1 3235448..3235615(-) (comX) [Bacillus subtilis strain SZMC 6179J isolate B23]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=176076 A3772_RS17130 WP_003242801.1 3235448..3235615(-) (comX) [Bacillus subtilis strain SZMC 6179J isolate B23]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment