Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   A2I97_RS14840 Genome accession   NZ_CP014990
Coordinates   3001951..3002091 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain KD1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2996951..3007091
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A2I97_RS14815 (A2I97_14325) - 2997248..2997631 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  A2I97_RS14820 (A2I97_14330) comA 2997653..2998297 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  A2I97_RS14825 (A2I97_14335) comP 2998378..3000681 (-) 2304 WP_070082286.1 sensor histidine kinase Regulator
  A2I97_RS14835 (A2I97_14345) comQ 3000834..3001766 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  A2I97_RS14840 (A2I97_14350) degQ 3001951..3002091 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  A2I97_RS14850 (A2I97_14355) - 3002557..3002898 (+) 342 WP_014305721.1 hypothetical protein -
  A2I97_RS14855 (A2I97_14360) - 3002905..3004125 (-) 1221 WP_070082287.1 EAL and HDOD domain-containing protein -
  A2I97_RS14860 (A2I97_14365) - 3004255..3005721 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  A2I97_RS14865 (A2I97_14370) - 3005739..3006290 (-) 552 WP_070082288.1 cysteine hydrolase family protein -
  A2I97_RS14870 (A2I97_14375) - 3006387..3006785 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=175799 A2I97_RS14840 WP_003152043.1 3001951..3002091(-) (degQ) [Bacillus velezensis strain KD1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=175799 A2I97_RS14840 WP_003152043.1 3001951..3002091(-) (degQ) [Bacillus velezensis strain KD1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment