Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   BCBMB205_RS11780 Genome accession   NZ_CP014838
Coordinates   2439900..2440214 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain CBMB205     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2434900..2445214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BCBMB205_RS11735 (BCBMB205_23800) sinI 2435581..2435754 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  BCBMB205_RS11740 (BCBMB205_23810) sinR 2435788..2436123 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BCBMB205_RS11745 (BCBMB205_23820) tasA 2436171..2436956 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  BCBMB205_RS11750 (BCBMB205_23830) sipW 2437021..2437605 (-) 585 WP_032874025.1 signal peptidase I SipW -
  BCBMB205_RS11755 (BCBMB205_23840) tapA 2437577..2438248 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  BCBMB205_RS11760 (BCBMB205_23860) - 2438507..2438836 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  BCBMB205_RS11765 (BCBMB205_23870) - 2438877..2439056 (-) 180 WP_022552966.1 YqzE family protein -
  BCBMB205_RS11770 (BCBMB205_23880) comGG 2439113..2439490 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  BCBMB205_RS11775 (BCBMB205_23890) comGF 2439491..2439991 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  BCBMB205_RS11780 (BCBMB205_23900) comGE 2439900..2440214 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  BCBMB205_RS11785 (BCBMB205_23910) comGD 2440198..2440635 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BCBMB205_RS11790 (BCBMB205_23920) comGC 2440625..2440891 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  BCBMB205_RS11795 (BCBMB205_23930) comGB 2440938..2441975 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  BCBMB205_RS11800 (BCBMB205_23940) comGA 2441962..2443032 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BCBMB205_RS11805 (BCBMB205_23950) - 2443229..2444179 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=174552 BCBMB205_RS11780 WP_032874016.1 2439900..2440214(-) (comGE) [Bacillus velezensis strain CBMB205]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=174552 BCBMB205_RS11780 WP_032874016.1 2439900..2440214(-) (comGE) [Bacillus velezensis strain CBMB205]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment