Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BCBMB205_RS11735 Genome accession   NZ_CP014838
Coordinates   2435581..2435754 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain CBMB205     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430581..2440754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BCBMB205_RS11720 (BCBMB205_23770) gcvT 2431395..2432495 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  BCBMB205_RS11725 (BCBMB205_23780) - 2432918..2434588 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  BCBMB205_RS11730 (BCBMB205_23790) - 2434610..2435404 (+) 795 WP_007612541.1 YqhG family protein -
  BCBMB205_RS11735 (BCBMB205_23800) sinI 2435581..2435754 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  BCBMB205_RS11740 (BCBMB205_23810) sinR 2435788..2436123 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BCBMB205_RS11745 (BCBMB205_23820) tasA 2436171..2436956 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  BCBMB205_RS11750 (BCBMB205_23830) sipW 2437021..2437605 (-) 585 WP_032874025.1 signal peptidase I SipW -
  BCBMB205_RS11755 (BCBMB205_23840) tapA 2437577..2438248 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  BCBMB205_RS11760 (BCBMB205_23860) - 2438507..2438836 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  BCBMB205_RS11765 (BCBMB205_23870) - 2438877..2439056 (-) 180 WP_022552966.1 YqzE family protein -
  BCBMB205_RS11770 (BCBMB205_23880) comGG 2439113..2439490 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  BCBMB205_RS11775 (BCBMB205_23890) comGF 2439491..2439991 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  BCBMB205_RS11780 (BCBMB205_23900) comGE 2439900..2440214 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  BCBMB205_RS11785 (BCBMB205_23910) comGD 2440198..2440635 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=174549 BCBMB205_RS11735 WP_032874029.1 2435581..2435754(+) (sinI) [Bacillus velezensis strain CBMB205]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=174549 BCBMB205_RS11735 WP_032874029.1 2435581..2435754(+) (sinI) [Bacillus velezensis strain CBMB205]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment