Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AWV81_RS12825 Genome accession   NZ_CP014471
Coordinates   2375307..2375681 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis subsp. natto strain CGMCC 2108     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2370307..2380681
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AWV81_RS12785 (AWV81_12780) yqhG 2370639..2371433 (+) 795 WP_014480249.1 YqhG family protein -
  AWV81_RS12790 (AWV81_12785) sinI 2371616..2371789 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AWV81_RS12795 (AWV81_12790) sinR 2371823..2372158 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AWV81_RS12800 (AWV81_12795) tasA 2372251..2373036 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  AWV81_RS12805 (AWV81_12800) sipW 2373100..2373672 (-) 573 WP_003230181.1 signal peptidase I SipW -
  AWV81_RS12810 (AWV81_12805) tapA 2373656..2374417 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  AWV81_RS12815 (AWV81_12810) yqzG 2374689..2375015 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AWV81_RS12820 (AWV81_12815) spoIITA 2375057..2375236 (-) 180 WP_014480252.1 YqzE family protein -
  AWV81_RS12825 (AWV81_12820) comGG 2375307..2375681 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AWV81_RS12830 (AWV81_12825) comGF 2375682..2376065 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  AWV81_RS12835 (AWV81_12830) comGE 2376091..2376438 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  AWV81_RS12840 (AWV81_12835) comGD 2376422..2376853 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  AWV81_RS12845 (AWV81_12840) comGC 2376843..2377139 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AWV81_RS12850 (AWV81_12845) comGB 2377153..2378190 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  AWV81_RS12855 (AWV81_12850) comGA 2378177..2379247 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AWV81_RS12865 (AWV81_12860) - 2379459..2379656 (-) 198 WP_014480259.1 CBS domain-containing protein -
  AWV81_RS12870 (AWV81_12865) corA 2379658..2380611 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=171728 AWV81_RS12825 WP_014480253.1 2375307..2375681(-) (comGG) [Bacillus subtilis subsp. natto strain CGMCC 2108]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=171728 AWV81_RS12825 WP_014480253.1 2375307..2375681(-) (comGG) [Bacillus subtilis subsp. natto strain CGMCC 2108]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment