Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AWV81_RS12790 Genome accession   NZ_CP014471
Coordinates   2371616..2371789 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. natto strain CGMCC 2108     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2366616..2376789
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AWV81_RS12775 (AWV81_12770) gcvT 2367415..2368503 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  AWV81_RS12780 (AWV81_12775) hepAA 2368945..2370618 (+) 1674 WP_014480248.1 SNF2-related protein -
  AWV81_RS12785 (AWV81_12780) yqhG 2370639..2371433 (+) 795 WP_014480249.1 YqhG family protein -
  AWV81_RS12790 (AWV81_12785) sinI 2371616..2371789 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AWV81_RS12795 (AWV81_12790) sinR 2371823..2372158 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AWV81_RS12800 (AWV81_12795) tasA 2372251..2373036 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  AWV81_RS12805 (AWV81_12800) sipW 2373100..2373672 (-) 573 WP_003230181.1 signal peptidase I SipW -
  AWV81_RS12810 (AWV81_12805) tapA 2373656..2374417 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  AWV81_RS12815 (AWV81_12810) yqzG 2374689..2375015 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AWV81_RS12820 (AWV81_12815) spoIITA 2375057..2375236 (-) 180 WP_014480252.1 YqzE family protein -
  AWV81_RS12825 (AWV81_12820) comGG 2375307..2375681 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AWV81_RS12830 (AWV81_12825) comGF 2375682..2376065 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  AWV81_RS12835 (AWV81_12830) comGE 2376091..2376438 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=171726 AWV81_RS12790 WP_003230187.1 2371616..2371789(+) (sinI) [Bacillus subtilis subsp. natto strain CGMCC 2108]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=171726 AWV81_RS12790 WP_003230187.1 2371616..2371789(+) (sinI) [Bacillus subtilis subsp. natto strain CGMCC 2108]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment