Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AWV81_RS12790 | Genome accession | NZ_CP014471 |
| Coordinates | 2371616..2371789 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. natto strain CGMCC 2108 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2366616..2376789
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AWV81_RS12775 (AWV81_12770) | gcvT | 2367415..2368503 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AWV81_RS12780 (AWV81_12775) | hepAA | 2368945..2370618 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| AWV81_RS12785 (AWV81_12780) | yqhG | 2370639..2371433 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| AWV81_RS12790 (AWV81_12785) | sinI | 2371616..2371789 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| AWV81_RS12795 (AWV81_12790) | sinR | 2371823..2372158 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AWV81_RS12800 (AWV81_12795) | tasA | 2372251..2373036 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| AWV81_RS12805 (AWV81_12800) | sipW | 2373100..2373672 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| AWV81_RS12810 (AWV81_12805) | tapA | 2373656..2374417 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AWV81_RS12815 (AWV81_12810) | yqzG | 2374689..2375015 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| AWV81_RS12820 (AWV81_12815) | spoIITA | 2375057..2375236 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| AWV81_RS12825 (AWV81_12820) | comGG | 2375307..2375681 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| AWV81_RS12830 (AWV81_12825) | comGF | 2375682..2376065 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| AWV81_RS12835 (AWV81_12830) | comGE | 2376091..2376438 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=171726 AWV81_RS12790 WP_003230187.1 2371616..2371789(+) (sinI) [Bacillus subtilis subsp. natto strain CGMCC 2108]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=171726 AWV81_RS12790 WP_003230187.1 2371616..2371789(+) (sinI) [Bacillus subtilis subsp. natto strain CGMCC 2108]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |