Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   SE1UMMC_RS03155 Genome accession   NZ_CP013943
Coordinates   611370..611945 (+) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain DAR1907     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 612346..654544 611370..611945 flank 401


Gene organization within MGE regions


Location: 611370..654544
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SE1UMMC_RS03155 (SE1UMMC_02925) comK/comK1 611370..611945 (+) 576 WP_001829272.1 competence protein ComK Regulator
  SE1UMMC_RS03170 (SE1UMMC_02940) - 612346..613395 (-) 1050 WP_101750498.1 tyrosine-type recombinase/integrase -
  SE1UMMC_RS03175 (SE1UMMC_02945) - 613555..614223 (-) 669 WP_101750499.1 hypothetical protein -
  SE1UMMC_RS03180 (SE1UMMC_02950) - 614241..614699 (-) 459 WP_002504200.1 ImmA/IrrE family metallo-endopeptidase -
  SE1UMMC_RS03185 (SE1UMMC_02955) - 614721..615035 (-) 315 WP_002504199.1 helix-turn-helix domain-containing protein -
  SE1UMMC_RS03190 (SE1UMMC_02960) - 615188..615400 (+) 213 WP_101750500.1 helix-turn-helix transcriptional regulator -
  SE1UMMC_RS13910 - 615444..615584 (+) 141 WP_002485815.1 hypothetical protein -
  SE1UMMC_RS03195 (SE1UMMC_02965) - 615577..615801 (-) 225 WP_002504198.1 hypothetical protein -
  SE1UMMC_RS03200 (SE1UMMC_02970) - 615851..616591 (+) 741 WP_002504197.1 phage repressor protein -
  SE1UMMC_RS03205 (SE1UMMC_02975) - 616604..616813 (+) 210 WP_001830281.1 hypothetical protein -
  SE1UMMC_RS13915 - 616827..616973 (+) 147 WP_002484748.1 hypothetical protein -
  SE1UMMC_RS03210 (SE1UMMC_02980) - 616960..617238 (-) 279 WP_002484728.1 hypothetical protein -
  SE1UMMC_RS13920 - 617333..617509 (+) 177 WP_199559955.1 hypothetical protein -
  SE1UMMC_RS03215 (SE1UMMC_02985) - 617571..617840 (+) 270 WP_101750501.1 chordopoxvirus fusion protein -
  SE1UMMC_RS03220 (SE1UMMC_02990) - 617818..618069 (+) 252 WP_002485808.1 hypothetical protein -
  SE1UMMC_RS03225 (SE1UMMC_02995) - 618062..618706 (+) 645 WP_002485844.1 DUF1071 domain-containing protein -
  SE1UMMC_RS03230 (SE1UMMC_03000) ssbA 618696..619124 (+) 429 WP_101750502.1 single-stranded DNA-binding protein Machinery gene
  SE1UMMC_RS03235 (SE1UMMC_03005) - 619138..619812 (+) 675 WP_002485820.1 putative HNHc nuclease -
  SE1UMMC_RS03240 (SE1UMMC_03010) - 619964..620665 (+) 702 WP_101750503.1 helix-turn-helix domain-containing protein -
  SE1UMMC_RS03245 (SE1UMMC_03015) - 620671..621024 (+) 354 WP_101750504.1 hypothetical protein -
  SE1UMMC_RS03250 (SE1UMMC_03020) - 621014..622261 (+) 1248 WP_001830247.1 DnaB-like helicase C-terminal domain-containing protein -
  SE1UMMC_RS03255 (SE1UMMC_03025) - 622258..622479 (+) 222 WP_001830239.1 hypothetical protein -
  SE1UMMC_RS03260 (SE1UMMC_03030) - 622457..622702 (+) 246 WP_002469496.1 hypothetical protein -
  SE1UMMC_RS03265 (SE1UMMC_03035) - 622712..623125 (+) 414 WP_002469467.1 DUF1064 domain-containing protein -
  SE1UMMC_RS03270 (SE1UMMC_03040) - 623112..623576 (+) 465 WP_002469486.1 hypothetical protein -
  SE1UMMC_RS03275 (SE1UMMC_03045) - 623528..623719 (+) 192 WP_002469484.1 hypothetical protein -
  SE1UMMC_RS03280 (SE1UMMC_03050) - 623720..624079 (+) 360 WP_101750505.1 SA1788 family PVL leukocidin-associated protein -
  SE1UMMC_RS03285 (SE1UMMC_03055) - 624076..624519 (+) 444 WP_101750506.1 DUF3310 domain-containing protein -
  SE1UMMC_RS03290 (SE1UMMC_03060) - 624467..625096 (+) 630 WP_099800579.1 NUMOD4 domain-containing protein -
  SE1UMMC_RS03295 (SE1UMMC_03065) - 625099..625779 (+) 681 WP_101750507.1 hypothetical protein -
  SE1UMMC_RS03300 (SE1UMMC_03070) - 625776..625961 (+) 186 WP_002500115.1 hypothetical protein -
  SE1UMMC_RS03305 (SE1UMMC_03075) - 625949..626305 (+) 357 WP_418855211.1 thermonuclease family protein -
  SE1UMMC_RS03310 (SE1UMMC_03080) - 626309..626608 (+) 300 WP_101750508.1 hypothetical protein -
  SE1UMMC_RS03315 (SE1UMMC_03085) - 626598..626846 (+) 249 WP_001830273.1 hypothetical protein -
  SE1UMMC_RS03320 (SE1UMMC_03090) - 626836..627015 (+) 180 WP_002504360.1 DUF1024 family protein -
  SE1UMMC_RS03325 (SE1UMMC_03095) - 627008..627331 (+) 324 WP_101750509.1 MazG-like family protein -
  SE1UMMC_RS03330 (SE1UMMC_03100) - 627342..627971 (+) 630 WP_142379577.1 hypothetical protein -
  SE1UMMC_RS03335 (SE1UMMC_03105) - 628025..628345 (+) 321 WP_101750510.1 hypothetical protein -
  SE1UMMC_RS03340 (SE1UMMC_03110) - 628365..628568 (+) 204 WP_101750511.1 DUF1381 domain-containing protein -
  SE1UMMC_RS03345 (SE1UMMC_03115) rinB 628581..628748 (+) 168 WP_002504175.1 transcriptional activator RinB -
  SE1UMMC_RS03350 - 628748..628897 (+) 150 WP_002500107.1 DUF1514 family protein -
  SE1UMMC_RS03355 (SE1UMMC_03120) - 628914..629360 (+) 447 WP_002453536.1 transcriptional regulator -
  SE1UMMC_RS03360 (SE1UMMC_03125) - 629956..630306 (+) 351 WP_049392021.1 HNH endonuclease -
  SE1UMMC_RS03365 (SE1UMMC_03130) - 630478..630945 (+) 468 WP_002456394.1 phage terminase small subunit P27 family -
  SE1UMMC_RS03370 (SE1UMMC_03135) - 630932..632626 (+) 1695 WP_002500103.1 terminase large subunit -
  SE1UMMC_RS03375 (SE1UMMC_03140) - 632638..632832 (+) 195 WP_002500102.1 hypothetical protein -
  SE1UMMC_RS03380 (SE1UMMC_03145) - 632832..634064 (+) 1233 WP_002485821.1 phage portal protein -
  SE1UMMC_RS03385 (SE1UMMC_03150) - 634054..634611 (+) 558 WP_002485849.1 HK97 family phage prohead protease -
  SE1UMMC_RS03390 (SE1UMMC_03155) - 634652..635995 (+) 1344 WP_002485824.1 phage major capsid protein -
  SE1UMMC_RS03395 (SE1UMMC_03160) - 636014..636355 (+) 342 WP_002485829.1 head-tail connector protein -
  SE1UMMC_RS03400 (SE1UMMC_03165) - 636345..636674 (+) 330 WP_002468167.1 hypothetical protein -
  SE1UMMC_RS03405 (SE1UMMC_03170) - 636671..637075 (+) 405 WP_002485860.1 hypothetical protein -
  SE1UMMC_RS03410 (SE1UMMC_03175) - 637080..637484 (+) 405 WP_002485830.1 hypothetical protein -
  SE1UMMC_RS03415 (SE1UMMC_03180) - 637497..638126 (+) 630 WP_101750512.1 major tail protein -
  SE1UMMC_RS03420 (SE1UMMC_03185) - 638145..638330 (+) 186 WP_002456405.1 hypothetical protein -
  SE1UMMC_RS03425 (SE1UMMC_03190) gpG 638394..638756 (+) 363 WP_002456406.1 phage tail assembly chaperone G -
  SE1UMMC_RS13785 gpGT 638789..638941 (+) 153 WP_002456407.1 phage tail assembly chaperone GT -
  SE1UMMC_RS03430 (SE1UMMC_03195) - 638970..639962 (+) 993 Protein_635 phage tail tape measure protein -
  SE1UMMC_RS03435 (SE1UMMC_03200) - 640081..641010 (+) 930 WP_101750513.1 DUF2726 domain-containing protein -
  SE1UMMC_RS03440 (SE1UMMC_03205) - 641188..644970 (+) 3783 WP_233486917.1 phage tail tape measure protein -
  SE1UMMC_RS03445 (SE1UMMC_03210) - 644972..645805 (+) 834 WP_002468177.1 phage tail domain-containing protein -
  SE1UMMC_RS03450 (SE1UMMC_03215) - 645815..647374 (+) 1560 WP_194088047.1 prophage endopeptidase tail family protein -
  SE1UMMC_RS13925 - 647367..647540 (+) 174 WP_002504159.1 hypothetical protein -
  SE1UMMC_RS03455 (SE1UMMC_03220) - 647556..649418 (+) 1863 WP_101750515.1 M14 family metallopeptidase -
  SE1UMMC_RS03460 (SE1UMMC_03225) - 649418..650632 (+) 1215 WP_101750516.1 BppU family phage baseplate upper protein -
  SE1UMMC_RS03465 (SE1UMMC_03230) - 650637..651260 (+) 624 WP_032604283.1 poly-gamma-glutamate hydrolase family protein -
  SE1UMMC_RS03470 (SE1UMMC_03235) - 651257..651682 (+) 426 WP_002499223.1 hypothetical protein -
  SE1UMMC_RS03475 (SE1UMMC_03240) - 651669..652076 (+) 408 WP_101750517.1 hypothetical protein -
  SE1UMMC_RS03480 (SE1UMMC_03245) - 652234..652632 (+) 399 WP_002499221.1 YxeA family protein -
  SE1UMMC_RS03485 (SE1UMMC_03250) - 652696..653106 (+) 411 WP_002499220.1 phage holin -
  SE1UMMC_RS03490 (SE1UMMC_03255) - 653081..654544 (+) 1464 WP_002499219.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=166389 SE1UMMC_RS03155 WP_001829272.1 611370..611945(+) (comK/comK1) [Staphylococcus epidermidis strain DAR1907]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=166389 SE1UMMC_RS03155 WP_001829272.1 611370..611945(+) (comK/comK1) [Staphylococcus epidermidis strain DAR1907]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains


Predicted by InterproScan.

(7-158)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743

  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743


Multiple sequence alignment