Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AVM03_RS09235 Genome accession   NZ_CP013727
Coordinates   1977265..1977405 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain MBE1283     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1972265..1982405
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AVM03_RS09210 (AVM03_09200) - 1972562..1972945 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  AVM03_RS09215 (AVM03_09205) comA 1972967..1973611 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AVM03_RS09220 (AVM03_09210) comP 1973692..1975995 (-) 2304 WP_003152050.1 sensor histidine kinase Regulator
  AVM03_RS09230 (AVM03_09220) comQ 1976148..1977080 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  AVM03_RS09235 (AVM03_09225) degQ 1977265..1977405 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AVM03_RS09245 (AVM03_09235) - 1977871..1978212 (+) 342 WP_014305721.1 hypothetical protein -
  AVM03_RS09250 (AVM03_09240) - 1978219..1979439 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  AVM03_RS09255 (AVM03_09245) - 1979569..1981035 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  AVM03_RS09260 (AVM03_09250) - 1981053..1981604 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  AVM03_RS09265 (AVM03_09255) - 1981701..1982099 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=164487 AVM03_RS09235 WP_003152043.1 1977265..1977405(-) (degQ) [Bacillus amyloliquefaciens strain MBE1283]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=164487 AVM03_RS09235 WP_003152043.1 1977265..1977405(-) (degQ) [Bacillus amyloliquefaciens strain MBE1283]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment