Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AT706_RS02875 Genome accession   NZ_CP013654
Coordinates   576541..576681 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain BSD-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 571541..581681
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AT706_RS02850 (AT706_02850) yueI 571835..572233 (+) 399 WP_015483635.1 YueI family protein -
  AT706_RS02855 (AT706_02855) pncA 572330..572881 (+) 552 WP_014477836.1 cysteine hydrolase family protein -
  AT706_RS02860 (AT706_02860) pncB 572897..574369 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AT706_RS02865 (AT706_02865) pdeH 574506..575735 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AT706_RS02870 (AT706_02870) - 575711..576079 (-) 369 WP_015483634.1 hypothetical protein -
  AT706_RS21535 - 576257..576319 (-) 63 Protein_572 hypothetical protein -
  AT706_RS02875 (AT706_02875) degQ 576541..576681 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AT706_RS02880 (AT706_02880) - 576866..577726 (+) 861 WP_015483633.1 polyprenyl synthetase family protein -
  AT706_RS02885 (AT706_02885) comX 577739..577903 (+) 165 WP_015384519.1 competence pheromone ComX -
  AT706_RS02890 (AT706_02890) comP 577915..580215 (+) 2301 WP_046340263.1 histidine kinase Regulator
  AT706_RS02895 (AT706_02895) comA 580296..580940 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AT706_RS02900 (AT706_02900) yuxO 580958..581338 (+) 381 WP_015483631.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=163500 AT706_RS02875 WP_003220708.1 576541..576681(+) (degQ) [Bacillus subtilis subsp. subtilis strain BSD-2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=163500 AT706_RS02875 WP_003220708.1 576541..576681(+) (degQ) [Bacillus subtilis subsp. subtilis strain BSD-2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment