Detailed information    

insolico Bioinformatically predicted

Overview

Name   ctsT   Type   Machinery gene
Locus tag   AEI05_RS05615 Genome accession   NZ_CP012205
Coordinates   1068637..1068939 (+) Length   100 a.a.
NCBI ID   WP_057042823.1    Uniprot ID   A0A5Y7GJZ7
Organism   Campylobacter jejuni strain CJ510CC45     
Function   type II secretion system/type IV pilin; DNA uptake (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1063637..1073939
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AEI05_RS05575 (AEI05_05610) fliW 1063816..1064085 (+) 270 Protein_1092 flagellar assembly protein FliW -
  AEI05_RS05580 (AEI05_05615) proC 1064085..1064816 (+) 732 WP_002859150.1 pyrroline-5-carboxylate reductase Machinery gene
  AEI05_RS05585 (AEI05_05620) ctsT 1064813..1065115 (+) 303 WP_002853046.1 type II secretion system protein Machinery gene
  AEI05_RS05590 - 1065112..1065264 (+) 153 Protein_1095 hypothetical protein -
  AEI05_RS05595 (AEI05_05625) - 1065265..1066695 (-) 1431 Protein_1096 LON peptidase substrate-binding domain-containing protein -
  AEI05_RS05600 (AEI05_05630) bamD 1066712..1067359 (-) 648 WP_002877748.1 outer membrane protein assembly factor BamD -
  AEI05_RS05605 (AEI05_05635) fliW 1067520..1067909 (+) 390 WP_002852982.1 flagellar assembly protein FliW -
  AEI05_RS05610 (AEI05_05640) proC 1067909..1068640 (+) 732 WP_002932769.1 pyrroline-5-carboxylate reductase Machinery gene
  AEI05_RS05615 (AEI05_05645) ctsT 1068637..1068939 (+) 303 WP_057042823.1 hypothetical protein Machinery gene
  AEI05_RS05620 (AEI05_05650) - 1068936..1069598 (+) 663 WP_002866103.1 hypothetical protein -
  AEI05_RS05625 (AEI05_05655) - 1069595..1070047 (+) 453 WP_032603535.1 hypothetical protein -
  AEI05_RS05630 (AEI05_05660) - 1070044..1070673 (-) 630 WP_002866105.1 uroporphyrinogen-III synthase -
  AEI05_RS05635 (AEI05_05665) thiE 1070651..1071283 (-) 633 WP_057042821.1 thiamine phosphate synthase -
  AEI05_RS05640 (AEI05_05670) thiD 1071273..1071902 (-) 630 Protein_1105 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
  AEI05_RS05645 (AEI05_05675) - 1071901..1072158 (+) 258 Protein_1106 hypothetical protein -
  AEI05_RS05650 (AEI05_05680) - 1072155..1072607 (+) 453 WP_002859148.1 hypothetical protein -
  AEI05_RS05655 (AEI05_05685) - 1072604..1073233 (-) 630 WP_002859147.1 uroporphyrinogen-III synthase -
  AEI05_RS05660 (AEI05_05690) thiE 1073211..1073843 (-) 633 WP_002852670.1 thiamine phosphate synthase -

Sequence

Protein


Download         Length: 100 a.a.        Molecular weight: 12163.30 Da        Isoelectric Point: 9.0653

>NTDB_id=152214 AEI05_RS05615 WP_057042823.1 1068637..1068939(+) (ctsT) [Campylobacter jejuni strain CJ510CC45]
MKKAFILIESISAITIISLIFIGIFYYYTQLYKNYENLNIFERLYKLQEELYEKPIFKTIILQTSALKPIILQEQFVNDG
IFQFQKLYFQDQNYSVYFKK

Nucleotide


Download         Length: 303 bp        

>NTDB_id=152214 AEI05_RS05615 WP_057042823.1 1068637..1068939(+) (ctsT) [Campylobacter jejuni strain CJ510CC45]
ATGAAAAAGGCTTTCATACTTATAGAAAGTATTAGTGCTATAACGATCATATCTTTAATTTTCATTGGCATTTTTTATTA
CTATACTCAACTTTACAAAAACTATGAAAATTTAAATATTTTTGAAAGACTCTATAAACTTCAAGAAGAATTATATGAAA
AGCCCATTTTTAAAACCATCATACTTCAAACTTCAGCCTTAAAACCTATAATTTTACAAGAACAGTTTGTTAATGATGGT
ATATTTCAATTTCAAAAATTATACTTTCAAGATCAAAATTATAGCGTTTATTTTAAAAAATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5Y7GJZ7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ctsT Campylobacter jejuni subsp. jejuni 81-176

98

100

0.98

Multiple sequence alignment