Detailed information    

experimental Experimentally validated

Overview

Name   ctsT   Type   Machinery gene
Locus tag   CJJ81176_RS05230 Genome accession   NC_008787
Coordinates   1013323..1013625 (+) Length   100 a.a.
NCBI ID   WP_002855822.1    Uniprot ID   A0A1E7NY14
Organism   Campylobacter jejuni subsp. jejuni 81-176     
Function   type II secretion system/type IV pilin; DNA uptake   
DNA binding and uptake

Function

Several of these mutants (ceuB::solo, ctsG::solo, proC::solo, and ctsT::solo) take up DNA at background levels, much like the strains with solo insertions in the operon ranging from ctsR to ctsF. In these mutants and in the type II secretion system mutants, we were unable to distinguish whether the transformation defect lies in transport of DNA across the outer membrane or if the defect is in the binding step of transformation, since the results from our DNA-binding assays were not consistent.


Genomic Context

Location: 1008323..1018625
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJJ81176_RS05205 (CJJ81176_1090) rpsR 1008686..1008946 (+) 261 WP_002853032.1 30S ribosomal protein S18 -
  CJJ81176_RS05210 (CJJ81176_1091) lon 1009006..1011381 (-) 2376 WP_002853487.1 endopeptidase La -
  CJJ81176_RS05215 (CJJ81176_1092) - 1011398..1012045 (-) 648 WP_002852961.1 outer membrane protein assembly factor BamD -
  CJJ81176_RS05220 (CJJ81176_1093) fliW 1012206..1012595 (+) 390 WP_002852982.1 flagellar assembly protein FliW -
  CJJ81176_RS05225 (CJJ81176_1094) proC 1012595..1013326 (+) 732 WP_002869050.1 pyrroline-5-carboxylate reductase Machinery gene
  CJJ81176_RS05230 (CJJ81176_1095) ctsT 1013323..1013625 (+) 303 WP_002855822.1 transformation system protein Machinery gene
  CJJ81176_RS05235 (CJJ81176_1096) - 1013622..1014284 (+) 663 WP_002866103.1 hypothetical protein -
  CJJ81176_RS05240 (CJJ81176_1097) - 1014281..1014733 (+) 453 WP_002869049.1 hypothetical protein -
  CJJ81176_RS05245 (CJJ81176_1098) hemD 1014730..1015359 (-) 630 WP_002856298.1 uroporphyrinogen-III synthase -
  CJJ81176_RS05250 (CJJ81176_1099) thiE 1015337..1015969 (-) 633 WP_002856400.1 thiamine phosphate synthase -
  CJJ81176_RS05255 (CJJ81176_1100) thiD 1015959..1016771 (-) 813 WP_002869047.1 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
  CJJ81176_RS05260 (CJJ81176_1101) - 1016768..1017454 (-) 687 WP_002869046.1 3-methyladenine DNA glycosylase -
  CJJ81176_RS05265 (CJJ81176_1102) - 1017451..1018212 (-) 762 WP_002856328.1 ATP-binding protein -

Sequence

Protein


Download         Length: 100 a.a.        Molecular weight: 12150.21 Da        Isoelectric Point: 6.2957

>NTDB_id=1232 CJJ81176_RS05230 WP_002855822.1 1013323..1013625(+) (ctsT) [Campylobacter jejuni subsp. jejuni 81-176]
MKKAFILIESISAITIISLIFIGIFYYYTQLYKNYENLNIFERLYKLQEELYEKPIFKTIILQTSALKPIVLQEQFVNDG
IFQFQKLYFQDQNYSVYFKE

Nucleotide


Download         Length: 303 bp        

>NTDB_id=1232 CJJ81176_RS05230 WP_002855822.1 1013323..1013625(+) (ctsT) [Campylobacter jejuni subsp. jejuni 81-176]
ATGAAAAAGGCTTTCATACTTATAGAAAGTATTAGTGCTATAACGATCATATCTTTAATTTTCATTGGCATTTTTTATTA
CTATACTCAACTTTACAAAAACTATGAAAATTTAAATATTTTTGAAAGACTCTATAAACTTCAAGAAGAATTATATGAAA
AGCCCATTTTTAAAACCATCATACTTCAAACTTCAGCCTTAAAACCTATAGTTTTACAAGAACAGTTTGTTAATGATGGT
ATATTTCAATTTCAAAAATTATACTTTCAAGATCAAAATTATAGCGTTTATTTTAAAGAATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1E7NY14

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Rebecca S Wiesner et al. (2003) Natural transformation of Campylobacter jejuni requires components of a type II secretion system. Journal of Bacteriology 185(18):5408-18. [PMID: 12949093]