Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilL   Type   Machinery gene
Locus tag   WX60_RS00060 Genome accession   NZ_CP012027
Coordinates   9088..9561 (+) Length   157 a.a.
NCBI ID   WP_025455985.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain FA6140     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4506..49481 9088..9561 within 0


Gene organization within MGE regions


Location: 4506..49481
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WX60_RS00035 (WX60_00006) dnaB 4506..5912 (+) 1407 WP_010359914.1 replicative DNA helicase -
  WX60_RS00040 (WX60_00007) pilH 6220..6882 (+) 663 WP_025455984.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  WX60_RS00045 (WX60_00008) pilI 6914..7531 (+) 618 WP_010359918.1 type IV pilus modification protein PilV Machinery gene
  WX60_RS00050 (WX60_00009) pilJ 7528..8496 (+) 969 WP_010359920.1 PilW family protein Machinery gene
  WX60_RS00055 (WX60_00010) pilK 8475..9086 (+) 612 WP_010359922.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  WX60_RS00060 (WX60_00011) pilL 9088..9561 (+) 474 WP_025455985.1 PilX family type IV pilin Machinery gene
  WX60_RS00065 (WX60_00012) - 9631..9939 (-) 309 WP_010359926.1 AzlD family protein -
  WX60_RS13425 - 9936..10646 (-) 711 Protein_14 AzlC family ABC transporter permease -
  WX60_RS00075 (WX60_00014) dut 10812..11264 (+) 453 WP_010359930.1 dUTP diphosphatase -
  WX60_RS00080 (WX60_00015) dapC 11342..12529 (+) 1188 WP_010359932.1 succinyldiaminopimelate transaminase -
  WX60_RS00085 (WX60_00016) yaaA 12840..13619 (+) 780 WP_003706583.1 peroxide stress protein YaaA -
  WX60_RS00100 (WX60_00019) - 14150..15343 (+) 1194 WP_010359935.1 phage integrase central domain-containing protein -
  WX60_RS00110 (WX60_00020) - 15699..15968 (-) 270 WP_003687928.1 hypothetical protein -
  WX60_RS00115 (WX60_00022) - 16163..16846 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  WX60_RS15625 - 17127..17393 (-) 267 Protein_21 hypothetical protein -
  WX60_RS00125 (WX60_00024) - 17504..17719 (-) 216 WP_003691538.1 hypothetical protein -
  WX60_RS00130 (WX60_00025) - 17771..18262 (-) 492 WP_010359966.1 siphovirus Gp157 family protein -
  WX60_RS00135 (WX60_00026) - 18259..18441 (-) 183 WP_003691535.1 hypothetical protein -
  WX60_RS00140 (WX60_00027) - 18581..19267 (-) 687 WP_010359969.1 phage replication initiation protein, NGO0469 family -
  WX60_RS14625 (WX60_00028) - 19336..19497 (-) 162 WP_003691530.1 hypothetical protein -
  WX60_RS00150 (WX60_00029) - 19494..19769 (-) 276 WP_010359972.1 NGO1622 family putative holin -
  WX60_RS00155 (WX60_00030) - 19922..20254 (-) 333 WP_003695500.1 hypothetical protein -
  WX60_RS00160 (WX60_00031) - 20395..20676 (-) 282 WP_010359985.1 hypothetical protein -
  WX60_RS00165 (WX60_00032) - 20673..21149 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  WX60_RS00170 (WX60_00033) - 21182..21382 (-) 201 WP_010359988.1 hypothetical protein -
  WX60_RS00175 (WX60_00034) - 21866..22084 (+) 219 WP_003691731.1 hypothetical protein -
  WX60_RS00180 (WX60_00035) - 22101..22460 (-) 360 WP_003691733.1 hypothetical protein -
  WX60_RS00185 (WX60_00036) - 22461..23000 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  WX60_RS00190 (WX60_00037) - 23160..23876 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  WX60_RS00195 (WX60_00038) - 24257..24484 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  WX60_RS14630 (WX60_00039) - 24481..24618 (+) 138 WP_010359998.1 hypothetical protein -
  WX60_RS00200 (WX60_00040) - 24602..25732 (+) 1131 WP_048589519.1 hypothetical protein -
  WX60_RS00205 (WX60_00041) - 25729..27090 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  WX60_RS00210 (WX60_00042) - 27107..27337 (+) 231 WP_033909710.1 hypothetical protein -
  WX60_RS00215 (WX60_00043) - 27429..27923 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  WX60_RS14635 (WX60_00044) - 28308..28457 (+) 150 WP_003689110.1 hypothetical protein -
  WX60_RS15065 (WX60_00045) - 28485..28754 (+) 270 WP_047921130.1 hypothetical protein -
  WX60_RS00230 (WX60_00046) - 28745..29119 (+) 375 WP_235430196.1 RusA family crossover junction endodeoxyribonuclease -
  WX60_RS00235 (WX60_00047) - 29116..29418 (+) 303 WP_003704256.1 DUF1364 domain-containing protein -
  WX60_RS00240 (WX60_00048) - 29415..29798 (+) 384 WP_003687982.1 recombination protein NinB -
  WX60_RS00245 (WX60_00049) - 29789..30307 (+) 519 WP_003687984.1 HNH endonuclease -
  WX60_RS00250 (WX60_00050) - 30372..30794 (+) 423 WP_003704254.1 hypothetical protein -
  WX60_RS00255 (WX60_00051) - 30794..31036 (+) 243 WP_003706439.1 hypothetical protein -
  WX60_RS00260 (WX60_00052) - 31091..31333 (+) 243 WP_003687989.1 hypothetical protein -
  WX60_RS00265 (WX60_00053) - 31314..32588 (+) 1275 WP_003687990.1 PBSX family phage terminase large subunit -
  WX60_RS00270 (WX60_00054) - 32573..34840 (+) 2268 WP_228841300.1 hypothetical protein -
  WX60_RS00275 (WX60_00055) - 35170..36048 (+) 879 WP_003706434.1 KilA-N domain-containing protein -
  WX60_RS00280 (WX60_00056) - 36294..37490 (+) 1197 WP_003693452.1 hypothetical protein -
  WX60_RS00285 (WX60_00057) - 37487..38701 (+) 1215 WP_010360402.1 hypothetical protein -
  WX60_RS15750 (WX60_00058) - 38904..44837 (+) 5934 WP_025456003.1 PLxRFG domain-containing protein -
  WX60_RS00300 (WX60_00060) - 45463..46758 (+) 1296 WP_003695011.1 DUF4043 family protein -
  WX60_RS00305 (WX60_00061) - 46813..47286 (+) 474 WP_003687996.1 hypothetical protein -
  WX60_RS00310 (WX60_00062) - 47292..47777 (+) 486 WP_003687997.1 hypothetical protein -
  WX60_RS00315 - 47774..48049 (+) 276 WP_010358526.1 hypothetical protein -
  WX60_RS00320 (WX60_00063) - 48040..48447 (+) 408 WP_010358525.1 hypothetical protein -
  WX60_RS00325 (WX60_00064) - 48438..48599 (+) 162 WP_003687999.1 hypothetical protein -
  WX60_RS00330 (WX60_00065) - 48636..49481 (-) 846 WP_003701197.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17439.16 Da        Isoelectric Point: 9.7327

>NTDB_id=150578 WX60_RS00060 WP_025455985.1 9088..9561(+) (pilL) [Neisseria gonorrhoeae strain FA6140]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYSVSVRLVNEGKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRNAASAQAYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=150578 WX60_RS00060 WP_025455985.1 9088..9561(+) (pilL) [Neisseria gonorrhoeae strain FA6140]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGCGGCTTGTCAATGAGGGAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTCTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

93.631

100

0.936

  pilX Neisseria meningitidis 8013

85.35

100

0.854


Multiple sequence alignment