Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ABH13_RS02045 Genome accession   NZ_CP011686
Coordinates   403390..403509 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain G341     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 398390..408509
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABH13_RS02030 (ABH13_0364) - 400002..400685 (+) 684 WP_007410267.1 response regulator transcription factor -
  ABH13_RS02035 (ABH13_0365) - 400672..402105 (+) 1434 WP_162782989.1 sensor histidine kinase -
  ABH13_RS02040 (ABH13_0367) rapC 402258..403406 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ABH13_RS02045 (ABH13_0368) phrC 403390..403509 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ABH13_RS19715 - 403657..403767 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  ABH13_RS02050 (ABH13_0369) - 403847..405211 (-) 1365 WP_020955323.1 aspartate kinase -
  ABH13_RS02055 (ABH13_0370) ceuB 405625..406578 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  ABH13_RS02060 (ABH13_0371) - 406568..407515 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ABH13_RS02065 (ABH13_0372) - 407509..408267 (+) 759 WP_047935217.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=147425 ABH13_RS02045 WP_003156334.1 403390..403509(+) (phrC) [Bacillus velezensis strain G341]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=147425 ABH13_RS02045 WP_003156334.1 403390..403509(+) (phrC) [Bacillus velezensis strain G341]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment