Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ABA10_RS12280 Genome accession   NZ_CP011534
Coordinates   2402306..2402479 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain UD1022     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2397306..2407479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABA10_RS12265 (ABA10_12265) gcvT 2398105..2399193 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  ABA10_RS12270 (ABA10_12270) hepAA 2399635..2401308 (+) 1674 WP_047182869.1 SNF2-related protein -
  ABA10_RS12275 (ABA10_12275) yqhG 2401329..2402123 (+) 795 WP_003230200.1 YqhG family protein -
  ABA10_RS12280 (ABA10_12280) sinI 2402306..2402479 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ABA10_RS12285 (ABA10_12285) sinR 2402513..2402848 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABA10_RS12290 (ABA10_12290) tasA 2402941..2403726 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ABA10_RS12295 (ABA10_12295) sipW 2403790..2404362 (-) 573 WP_080030740.1 signal peptidase I SipW -
  ABA10_RS12300 (ABA10_12300) tapA 2404346..2405107 (-) 762 WP_047182870.1 amyloid fiber anchoring/assembly protein TapA -
  ABA10_RS12305 (ABA10_12305) yqzG 2405377..2405703 (+) 327 WP_047183570.1 YqzG/YhdC family protein -
  ABA10_RS12310 (ABA10_12310) spoIITA 2405745..2405924 (-) 180 WP_003230176.1 YqzE family protein -
  ABA10_RS12315 (ABA10_12315) comGG 2405996..2406370 (-) 375 WP_047182871.1 ComG operon protein ComGG Machinery gene
  ABA10_RS12320 (ABA10_12320) comGF 2406371..2406754 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  ABA10_RS12325 (ABA10_12325) comGE 2406780..2407127 (-) 348 WP_047182872.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=146743 ABA10_RS12280 WP_003230187.1 2402306..2402479(+) (sinI) [Bacillus subtilis strain UD1022]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=146743 ABA10_RS12280 WP_003230187.1 2402306..2402479(+) (sinI) [Bacillus subtilis strain UD1022]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment