Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAV29_RS15700 Genome accession   NZ_CP011346
Coordinates   3210342..3210482 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JJ-D34     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3205342..3215482
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAV29_RS15675 (AAV29_15675) - 3205639..3206022 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  AAV29_RS15680 (AAV29_15680) comA 3206044..3206688 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AAV29_RS15685 (AAV29_15685) comP 3206769..3209072 (-) 2304 WP_046560013.1 histidine kinase Regulator
  AAV29_RS15695 (AAV29_15695) comQ 3209225..3210157 (-) 933 WP_046560238.1 class 1 isoprenoid biosynthesis enzyme Regulator
  AAV29_RS15700 (AAV29_15700) degQ 3210342..3210482 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AAV29_RS15710 (AAV29_15710) - 3210948..3211289 (+) 342 WP_046560014.1 hypothetical protein -
  AAV29_RS15715 (AAV29_15715) - 3211296..3212516 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  AAV29_RS15720 (AAV29_15720) - 3212646..3214112 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  AAV29_RS15725 (AAV29_15725) - 3214130..3214681 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  AAV29_RS15730 (AAV29_15730) - 3214778..3215176 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=144883 AAV29_RS15700 WP_003152043.1 3210342..3210482(-) (degQ) [Bacillus velezensis strain JJ-D34]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=144883 AAV29_RS15700 WP_003152043.1 3210342..3210482(-) (degQ) [Bacillus velezensis strain JJ-D34]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment