Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AWM80_RS16135 Genome accession   NZ_CP014166
Coordinates   3097772..3097912 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain CU1050     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3092772..3102912
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AWM80_RS16110 (AWM80_16115) yuxO 3093085..3093465 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  AWM80_RS16115 (AWM80_16120) comA 3093484..3094128 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AWM80_RS16120 (AWM80_16125) comP 3094209..3096518 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  AWM80_RS16125 (AWM80_16130) comX 3096533..3096700 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  AWM80_RS16130 (AWM80_16135) comQ 3096688..3097587 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  AWM80_RS16135 (AWM80_16140) degQ 3097772..3097912 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AWM80_RS21785 - 3098134..3098259 (+) 126 WP_003228793.1 hypothetical protein -
  AWM80_RS16140 (AWM80_16145) - 3098373..3098741 (+) 369 WP_003243784.1 hypothetical protein -
  AWM80_RS16145 (AWM80_16150) pdeH 3098717..3099946 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AWM80_RS16150 (AWM80_16155) pncB 3100083..3101555 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AWM80_RS16155 (AWM80_16160) pncA 3101571..3102122 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  AWM80_RS16160 (AWM80_16165) yueI 3102219..3102617 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=144609 AWM80_RS16135 WP_003220708.1 3097772..3097912(-) (degQ) [Bacillus subtilis subsp. subtilis strain CU1050]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=144609 AWM80_RS16135 WP_003220708.1 3097772..3097912(-) (degQ) [Bacillus subtilis subsp. subtilis strain CU1050]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment