Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   AWM80_RS16125 Genome accession   NZ_CP014166
Coordinates   3096533..3096700 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis subsp. subtilis strain CU1050     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3091533..3101700
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AWM80_RS16095 (AWM80_16100) mrpE 3091928..3092404 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  AWM80_RS16100 (AWM80_16105) mrpF 3092404..3092688 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  AWM80_RS16105 (AWM80_16110) mnhG 3092672..3093046 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  AWM80_RS16110 (AWM80_16115) yuxO 3093085..3093465 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  AWM80_RS16115 (AWM80_16120) comA 3093484..3094128 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AWM80_RS16120 (AWM80_16125) comP 3094209..3096518 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  AWM80_RS16125 (AWM80_16130) comX 3096533..3096700 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  AWM80_RS16130 (AWM80_16135) comQ 3096688..3097587 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  AWM80_RS16135 (AWM80_16140) degQ 3097772..3097912 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AWM80_RS21785 - 3098134..3098259 (+) 126 WP_003228793.1 hypothetical protein -
  AWM80_RS16140 (AWM80_16145) - 3098373..3098741 (+) 369 WP_003243784.1 hypothetical protein -
  AWM80_RS16145 (AWM80_16150) pdeH 3098717..3099946 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AWM80_RS16150 (AWM80_16155) pncB 3100083..3101555 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=144607 AWM80_RS16125 WP_003242801.1 3096533..3096700(-) (comX) [Bacillus subtilis subsp. subtilis strain CU1050]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=144607 AWM80_RS16125 WP_003242801.1 3096533..3096700(-) (comX) [Bacillus subtilis subsp. subtilis strain CU1050]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment