Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | XM40_RS11495 | Genome accession | NZ_CP011278 |
| Coordinates | 2443203..2443376 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain L-S60 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2438203..2448376
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XM40_RS11480 (XM40_11480) | gcvT | 2439021..2440121 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| XM40_RS11485 (XM40_11485) | - | 2440544..2442214 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| XM40_RS11490 (XM40_11490) | - | 2442232..2443026 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| XM40_RS11495 (XM40_11495) | sinI | 2443203..2443376 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| XM40_RS11500 (XM40_11500) | sinR | 2443410..2443745 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| XM40_RS11505 (XM40_11505) | - | 2443793..2444578 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| XM40_RS11510 (XM40_11510) | - | 2444642..2445226 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| XM40_RS11515 (XM40_11515) | tapA | 2445198..2445869 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| XM40_RS11520 (XM40_11520) | - | 2446128..2446457 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| XM40_RS11525 (XM40_11525) | - | 2446497..2446676 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| XM40_RS11530 (XM40_11530) | comGG | 2446733..2447110 (-) | 378 | WP_043867284.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| XM40_RS11535 (XM40_11535) | comGF | 2447111..2447506 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| XM40_RS11540 (XM40_11540) | comGE | 2447520..2447834 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| XM40_RS11545 (XM40_11545) | comGD | 2447818..2448255 (-) | 438 | WP_043867285.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=144121 XM40_RS11495 WP_003153105.1 2443203..2443376(+) (sinI) [Bacillus velezensis strain L-S60]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=144121 XM40_RS11495 WP_003153105.1 2443203..2443376(+) (sinI) [Bacillus velezensis strain L-S60]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |