Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   XM40_RS11540 Genome accession   NZ_CP011278
Coordinates   2447520..2447834 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain L-S60     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2442520..2452834
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  XM40_RS11495 (XM40_11495) sinI 2443203..2443376 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  XM40_RS11500 (XM40_11500) sinR 2443410..2443745 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  XM40_RS11505 (XM40_11505) - 2443793..2444578 (-) 786 WP_003153102.1 TasA family protein -
  XM40_RS11510 (XM40_11510) - 2444642..2445226 (-) 585 WP_012117977.1 signal peptidase I -
  XM40_RS11515 (XM40_11515) tapA 2445198..2445869 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  XM40_RS11520 (XM40_11520) - 2446128..2446457 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  XM40_RS11525 (XM40_11525) - 2446497..2446676 (-) 180 WP_003153093.1 YqzE family protein -
  XM40_RS11530 (XM40_11530) comGG 2446733..2447110 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  XM40_RS11535 (XM40_11535) comGF 2447111..2447506 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  XM40_RS11540 (XM40_11540) comGE 2447520..2447834 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  XM40_RS11545 (XM40_11545) comGD 2447818..2448255 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  XM40_RS11550 (XM40_11550) comGC 2448245..2448553 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  XM40_RS11555 (XM40_11555) comGB 2448558..2449595 (-) 1038 WP_043867286.1 competence type IV pilus assembly protein ComGB Machinery gene
  XM40_RS11560 (XM40_11560) comGA 2449582..2450652 (-) 1071 WP_043867287.1 competence type IV pilus ATPase ComGA Machinery gene
  XM40_RS11565 (XM40_11565) - 2450850..2451800 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=144124 XM40_RS11540 WP_015388003.1 2447520..2447834(-) (comGE) [Bacillus velezensis strain L-S60]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=144124 XM40_RS11540 WP_015388003.1 2447520..2447834(-) (comGE) [Bacillus velezensis strain L-S60]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment