Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WV34_RS15010 Genome accession   NZ_CP011252
Coordinates   2955595..2955735 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain MT45     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2950595..2960735
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WV34_RS14985 (WV34_14625) - 2950935..2951318 (-) 384 WP_045509485.1 hotdog fold thioesterase -
  WV34_RS14990 (WV34_14630) comA 2951340..2951984 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  WV34_RS14995 (WV34_14635) comP 2952065..2954356 (-) 2292 WP_088613350.1 histidine kinase Regulator
  WV34_RS15000 (WV34_14640) comX 2954368..2954532 (-) 165 WP_007613432.1 competence pheromone ComX -
  WV34_RS15005 (WV34_14645) - 2954532..2955443 (-) 912 WP_088613883.1 polyprenyl synthetase family protein -
  WV34_RS15010 (WV34_14650) degQ 2955595..2955735 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  WV34_RS15020 (WV34_14655) - 2956200..2956541 (+) 342 WP_045509476.1 hypothetical protein -
  WV34_RS15025 (WV34_14660) - 2956548..2957771 (-) 1224 WP_045509474.1 EAL and HDOD domain-containing protein -
  WV34_RS15030 (WV34_14665) - 2957901..2959367 (-) 1467 WP_088613351.1 nicotinate phosphoribosyltransferase -
  WV34_RS15035 (WV34_14670) - 2959385..2959936 (-) 552 WP_088613352.1 isochorismatase family cysteine hydrolase -
  WV34_RS15040 (WV34_14675) - 2960017..2960412 (-) 396 WP_013353403.1 DUF1694 domain-containing protein -
  WV34_RS15045 (WV34_14680) - 2960478..2960726 (-) 249 WP_088613353.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=143911 WV34_RS15010 WP_013353398.1 2955595..2955735(-) (degQ) [Bacillus amyloliquefaciens strain MT45]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=143911 WV34_RS15010 WP_013353398.1 2955595..2955735(-) (degQ) [Bacillus amyloliquefaciens strain MT45]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913

Multiple sequence alignment