Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BIS30_RS02065 Genome accession   NZ_CP011051
Coordinates   358296..358670 (-) Length   124 a.a.
NCBI ID   WP_003226328.1    Uniprot ID   -
Organism   Bacillus spizizenii strain T30     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 353296..363670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BIS30_RS02025 (BIS30_02025) - 353626..354420 (+) 795 WP_003226349.1 YqhG family protein -
  BIS30_RS02030 (BIS30_02030) sinI 354606..354779 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  BIS30_RS02035 (BIS30_02035) sinR 354813..355148 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BIS30_RS02040 (BIS30_02040) tasA 355242..356027 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  BIS30_RS02045 (BIS30_02045) sipW 356091..356663 (-) 573 WP_003226338.1 signal peptidase I SipW -
  BIS30_RS02050 (BIS30_02050) tapA 356647..357408 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  BIS30_RS02055 (BIS30_02055) - 357677..358003 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  BIS30_RS02060 (BIS30_02060) - 358045..358224 (-) 180 WP_003226330.1 YqzE family protein -
  BIS30_RS02065 (BIS30_02065) comGG 358296..358670 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  BIS30_RS02070 (BIS30_02070) comGF 358671..359054 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  BIS30_RS02075 (BIS30_02075) comGE 359080..359427 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  BIS30_RS02080 (BIS30_02080) comGD 359411..359842 (-) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  BIS30_RS02085 (BIS30_02085) comGC 359832..360128 (-) 297 WP_003226319.1 comG operon protein ComGC Machinery gene
  BIS30_RS02090 (BIS30_02090) comGB 360142..361179 (-) 1038 WP_003226315.1 competence type IV pilus assembly protein ComGB Machinery gene
  BIS30_RS02095 (BIS30_02095) comGA 361166..362236 (-) 1071 WP_003226312.1 competence protein ComGA Machinery gene
  BIS30_RS02100 (BIS30_02100) - 362449..362859 (-) 411 WP_032727412.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14303.42 Da        Isoelectric Point: 8.7908

>NTDB_id=141751 BIS30_RS02065 WP_003226328.1 358296..358670(-) (comGG) [Bacillus spizizenii strain T30]
MDSTKGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKEFYTGENLLQNGALLSIRHVLEQRKGQKDSQQFPYGQVS
YYIHDTSIKEKKEINLKALTESGTERTAQIVFDQKQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=141751 BIS30_RS02065 WP_003226328.1 358296..358670(-) (comGG) [Bacillus spizizenii strain T30]
ATGGACAGCACGAAAGGGTTTATTTATCCCGCTGTTCTTTTTGTGTCTGCGCTTGTGCTGCTGATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTTTACACAGGAGAGAATTTGCTTCAGAATGGCG
CGCTTCTGTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGATTCACAGCAGTTTCCATATGGGCAGGTTTCT
TATTACATTCACGATACATCGATAAAAGAGAAAAAAGAAATCAACCTAAAAGCGTTGACGGAATCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

84.677

100

0.847

Multiple sequence alignment