Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BIS30_RS02030 Genome accession   NZ_CP011051
Coordinates   354606..354779 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus spizizenii strain T30     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 349606..359779
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BIS30_RS02015 (BIS30_02015) gcvT 350401..351489 (-) 1089 WP_003226353.1 glycine cleavage system aminomethyltransferase GcvT -
  BIS30_RS02020 (BIS30_02020) - 351932..353605 (+) 1674 WP_003226350.1 DEAD/DEAH box helicase -
  BIS30_RS02025 (BIS30_02025) - 353626..354420 (+) 795 WP_003226349.1 YqhG family protein -
  BIS30_RS02030 (BIS30_02030) sinI 354606..354779 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  BIS30_RS02035 (BIS30_02035) sinR 354813..355148 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BIS30_RS02040 (BIS30_02040) tasA 355242..356027 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  BIS30_RS02045 (BIS30_02045) sipW 356091..356663 (-) 573 WP_003226338.1 signal peptidase I SipW -
  BIS30_RS02050 (BIS30_02050) tapA 356647..357408 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  BIS30_RS02055 (BIS30_02055) - 357677..358003 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  BIS30_RS02060 (BIS30_02060) - 358045..358224 (-) 180 WP_003226330.1 YqzE family protein -
  BIS30_RS02065 (BIS30_02065) comGG 358296..358670 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  BIS30_RS02070 (BIS30_02070) comGF 358671..359054 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  BIS30_RS02075 (BIS30_02075) comGE 359080..359427 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=141749 BIS30_RS02030 WP_003226347.1 354606..354779(+) (sinI) [Bacillus spizizenii strain T30]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=141749 BIS30_RS02030 WP_003226347.1 354606..354779(+) (sinI) [Bacillus spizizenii strain T30]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965


Multiple sequence alignment