Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BIS30_RS02030 | Genome accession | NZ_CP011051 |
| Coordinates | 354606..354779 (+) | Length | 57 a.a. |
| NCBI ID | WP_003226347.1 | Uniprot ID | G4NQ83 |
| Organism | Bacillus spizizenii strain T30 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 349606..359779
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BIS30_RS02015 (BIS30_02015) | gcvT | 350401..351489 (-) | 1089 | WP_003226353.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BIS30_RS02020 (BIS30_02020) | - | 351932..353605 (+) | 1674 | WP_003226350.1 | DEAD/DEAH box helicase | - |
| BIS30_RS02025 (BIS30_02025) | - | 353626..354420 (+) | 795 | WP_003226349.1 | YqhG family protein | - |
| BIS30_RS02030 (BIS30_02030) | sinI | 354606..354779 (+) | 174 | WP_003226347.1 | anti-repressor SinI | Regulator |
| BIS30_RS02035 (BIS30_02035) | sinR | 354813..355148 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BIS30_RS02040 (BIS30_02040) | tasA | 355242..356027 (-) | 786 | WP_003226340.1 | biofilm matrix protein TasA | - |
| BIS30_RS02045 (BIS30_02045) | sipW | 356091..356663 (-) | 573 | WP_003226338.1 | signal peptidase I SipW | - |
| BIS30_RS02050 (BIS30_02050) | tapA | 356647..357408 (-) | 762 | WP_003226335.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BIS30_RS02055 (BIS30_02055) | - | 357677..358003 (+) | 327 | WP_079996407.1 | YqzG/YhdC family protein | - |
| BIS30_RS02060 (BIS30_02060) | - | 358045..358224 (-) | 180 | WP_003226330.1 | YqzE family protein | - |
| BIS30_RS02065 (BIS30_02065) | comGG | 358296..358670 (-) | 375 | WP_003226328.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BIS30_RS02070 (BIS30_02070) | comGF | 358671..359054 (-) | 384 | WP_032727308.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| BIS30_RS02075 (BIS30_02075) | comGE | 359080..359427 (-) | 348 | WP_003226323.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6632.64 Da Isoelectric Point: 8.6596
>NTDB_id=141749 BIS30_RS02030 WP_003226347.1 354606..354779(+) (sinI) [Bacillus spizizenii strain T30]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=141749 BIS30_RS02030 WP_003226347.1 354606..354779(+) (sinI) [Bacillus spizizenii strain T30]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
96.491 |
100 |
0.965 |