Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   BIS30_RS02075 Genome accession   NZ_CP011051
Coordinates   359080..359427 (-) Length   115 a.a.
NCBI ID   WP_003226323.1    Uniprot ID   E0U415
Organism   Bacillus spizizenii strain T30     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 354080..364427
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BIS30_RS02030 (BIS30_02030) sinI 354606..354779 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  BIS30_RS02035 (BIS30_02035) sinR 354813..355148 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BIS30_RS02040 (BIS30_02040) tasA 355242..356027 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  BIS30_RS02045 (BIS30_02045) sipW 356091..356663 (-) 573 WP_003226338.1 signal peptidase I SipW -
  BIS30_RS02050 (BIS30_02050) tapA 356647..357408 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  BIS30_RS02055 (BIS30_02055) - 357677..358003 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  BIS30_RS02060 (BIS30_02060) - 358045..358224 (-) 180 WP_003226330.1 YqzE family protein -
  BIS30_RS02065 (BIS30_02065) comGG 358296..358670 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  BIS30_RS02070 (BIS30_02070) comGF 358671..359054 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  BIS30_RS02075 (BIS30_02075) comGE 359080..359427 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  BIS30_RS02080 (BIS30_02080) comGD 359411..359842 (-) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  BIS30_RS02085 (BIS30_02085) comGC 359832..360128 (-) 297 WP_003226319.1 comG operon protein ComGC Machinery gene
  BIS30_RS02090 (BIS30_02090) comGB 360142..361179 (-) 1038 WP_003226315.1 competence type IV pilus assembly protein ComGB Machinery gene
  BIS30_RS02095 (BIS30_02095) comGA 361166..362236 (-) 1071 WP_003226312.1 competence protein ComGA Machinery gene
  BIS30_RS02100 (BIS30_02100) - 362449..362859 (-) 411 WP_032727412.1 CBS domain-containing protein -
  BIS30_RS02105 (BIS30_02105) - 362922..363875 (-) 954 WP_003226308.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13497.51 Da        Isoelectric Point: 4.3472

>NTDB_id=141753 BIS30_RS02075 WP_003226323.1 359080..359427(-) (comGE) [Bacillus spizizenii strain T30]
MWRENKGFSTIETMSALSLWLFLLLTVVPLWDKLIADENMAESREIGYQMMNENISKYMMTGEETEVKMITKNNNNYALK
WEEEGEYQNVCISAAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=141753 BIS30_RS02075 WP_003226323.1 359080..359427(-) (comGE) [Bacillus spizizenii strain T30]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTTTGCTGCTGACAGT
CGTTCCTTTGTGGGACAAACTGATAGCTGATGAAAATATGGCGGAATCTCGAGAAATCGGGTACCAAATGATGAATGAAA
ACATTAGCAAATATATGATGACTGGTGAAGAAACTGAGGTGAAAATGATTACAAAGAACAATAATAACTATGCGCTAAAG
TGGGAGGAGGAGGGGGAATATCAAAACGTATGCATATCAGCAGCAGCTTATAAAGAAAAACCATTTTGCCTCAGCATTCT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB E0U415

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

83.478

100

0.835


Multiple sequence alignment