Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   NY10_RS01970 Genome accession   NZ_CP010796
Coordinates   374104..374574 (+) Length   156 a.a.
NCBI ID   WP_058918415.1    Uniprot ID   A0A0U3MAP3
Organism   Carnobacterium sp. CP1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 356929..403048 374104..374574 within 0


Gene organization within MGE regions


Location: 356929..403048
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NY10_RS01845 (NY10_392) - 356929..357642 (+) 714 WP_058918392.1 DnaD domain-containing protein -
  NY10_RS01850 (NY10_393) nth 357659..358309 (+) 651 WP_058918393.1 endonuclease III -
  NY10_RS01855 (NY10_394) - 358451..361081 (-) 2631 WP_058918394.1 PBP1A family penicillin-binding protein -
  NY10_RS01860 (NY10_395) recU 361159..361794 (-) 636 WP_058918395.1 Holliday junction resolvase RecU -
  NY10_RS01865 (NY10_396) - 361865..362404 (+) 540 WP_058920199.1 DUF1273 domain-containing protein -
  NY10_RS01870 (NY10_397) gpsB 362565..362900 (+) 336 WP_058918396.1 cell division regulator GpsB -
  NY10_RS01875 (NY10_398) - 363410..364555 (+) 1146 WP_058918397.1 class I SAM-dependent RNA methyltransferase -
  NY10_RS01880 (NY10_399) - 365009..365281 (+) 273 WP_058918398.1 hypothetical protein -
  NY10_RS01890 (NY10_400) - 365688..366869 (-) 1182 WP_058918399.1 site-specific integrase -
  NY10_RS01895 (NY10_401) - 367018..367209 (-) 192 WP_058918400.1 hypothetical protein -
  NY10_RS01900 (NY10_402) - 367248..367910 (-) 663 WP_058918401.1 hypothetical protein -
  NY10_RS01905 (NY10_403) - 367983..368633 (-) 651 WP_058918402.1 XRE family transcriptional regulator -
  NY10_RS01910 (NY10_404) - 368805..369065 (+) 261 WP_058918403.1 helix-turn-helix transcriptional regulator -
  NY10_RS01915 (NY10_405) - 369102..369809 (+) 708 WP_058918404.1 BRO family protein -
  NY10_RS12525 (NY10_406) - 369810..369959 (+) 150 WP_156413247.1 hypothetical protein -
  NY10_RS01920 (NY10_407) - 369940..370275 (-) 336 WP_058918405.1 hypothetical protein -
  NY10_RS01925 (NY10_408) - 370413..370610 (+) 198 WP_058918406.1 helix-turn-helix transcriptional regulator -
  NY10_RS01930 (NY10_409) - 370616..370954 (+) 339 WP_058918407.1 DUF771 domain-containing protein -
  NY10_RS01935 (NY10_410) - 370959..371222 (+) 264 WP_058918408.1 hypothetical protein -
  NY10_RS12530 (NY10_411) - 371209..371349 (+) 141 WP_156413248.1 hypothetical protein -
  NY10_RS12535 (NY10_412) - 371362..371520 (+) 159 WP_156413249.1 hypothetical protein -
  NY10_RS01940 (NY10_413) - 371630..372550 (+) 921 WP_058918409.1 DnaD domain protein -
  NY10_RS01945 - 372572..372775 (+) 204 WP_156413250.1 hypothetical protein -
  NY10_RS01950 (NY10_414) - 372772..372987 (+) 216 WP_058918411.1 hypothetical protein -
  NY10_RS01955 (NY10_415) - 372984..373481 (+) 498 WP_058918412.1 hypothetical protein -
  NY10_RS01960 - 373478..373684 (+) 207 WP_058918413.1 hypothetical protein -
  NY10_RS01965 (NY10_417) - 373681..374103 (+) 423 WP_058918414.1 hypothetical protein -
  NY10_RS01970 (NY10_418) ssb 374104..374574 (+) 471 WP_058918415.1 single-stranded DNA-binding protein Machinery gene
  NY10_RS01975 (NY10_419) - 374588..375286 (+) 699 WP_058918416.1 putative HNHc nuclease -
  NY10_RS01980 (NY10_420) - 375313..375603 (+) 291 WP_058918417.1 hypothetical protein -
  NY10_RS01985 - 375596..375820 (+) 225 WP_058918418.1 hypothetical protein -
  NY10_RS12540 (NY10_422) - 376030..376203 (+) 174 WP_156413251.1 hypothetical protein -
  NY10_RS01990 (NY10_423) - 376200..376403 (+) 204 WP_058918419.1 hypothetical protein -
  NY10_RS12545 (NY10_424) - 376403..376567 (+) 165 WP_156413252.1 hypothetical protein -
  NY10_RS01995 (NY10_425) - 376568..377068 (+) 501 WP_058918420.1 DUF1642 domain-containing protein -
  NY10_RS02000 (NY10_426) - 377061..377285 (+) 225 WP_058918421.1 hypothetical protein -
  NY10_RS12385 (NY10_427) - 377301..377813 (+) 513 WP_082664153.1 nucleotide modification associated domain-containing protein -
  NY10_RS02010 (NY10_428) - 377828..378280 (+) 453 WP_058918422.1 hypothetical protein -
  NY10_RS02015 - 378545..379045 (+) 501 WP_058918423.1 HNH endonuclease -
  NY10_RS02020 (NY10_429) - 379167..379532 (+) 366 WP_058918424.1 hypothetical protein -
  NY10_RS02025 - 379522..379863 (+) 342 WP_058918425.1 HNH endonuclease -
  NY10_RS02035 (NY10_430) - 380032..380556 (+) 525 WP_058918427.1 phage terminase small subunit P27 family -
  NY10_RS02040 (NY10_431) - 380604..381551 (+) 948 WP_058918428.1 GIY-YIG nuclease family protein -
  NY10_RS02045 (NY10_432) - 381562..383277 (+) 1716 WP_058918429.1 terminase TerL endonuclease subunit -
  NY10_RS02055 (NY10_434) - 383540..384760 (+) 1221 WP_058918430.1 phage portal protein -
  NY10_RS02060 (NY10_435) - 384738..385457 (+) 720 WP_058918431.1 head maturation protease, ClpP-related -
  NY10_RS02065 (NY10_436) - 385514..386713 (+) 1200 WP_058918432.1 phage major capsid protein -
  NY10_RS12390 (NY10_437) - 386731..386853 (+) 123 WP_082664154.1 HeH/LEM domain-containing protein -
  NY10_RS02070 (NY10_438) - 386856..387167 (+) 312 WP_058918433.1 head-tail connector protein -
  NY10_RS02075 (NY10_439) - 387157..387507 (+) 351 WP_058918434.1 phage head closure protein -
  NY10_RS02080 (NY10_440) - 387504..387872 (+) 369 WP_058918435.1 HK97-gp10 family putative phage morphogenesis protein -
  NY10_RS02085 (NY10_441) - 387872..388294 (+) 423 WP_058918436.1 hypothetical protein -
  NY10_RS02090 (NY10_442) - 388316..388879 (+) 564 WP_058918437.1 major tail protein -
  NY10_RS02095 (NY10_443) - 388991..389308 (+) 318 WP_058918438.1 hypothetical protein -
  NY10_RS12550 (NY10_444) - 389332..389496 (+) 165 WP_156413253.1 hypothetical protein -
  NY10_RS02100 (NY10_445) - 389514..393563 (+) 4050 WP_058918439.1 phage tail tape measure protein -
  NY10_RS02105 (NY10_446) - 393560..394264 (+) 705 WP_058918440.1 hypothetical protein -
  NY10_RS02110 (NY10_447) - 394264..395838 (+) 1575 WP_058918441.1 phage tail spike protein -
  NY10_RS12555 - 395851..396015 (+) 165 WP_156413254.1 hypothetical protein -
  NY10_RS02115 (NY10_448) - 395999..396787 (-) 789 WP_058918442.1 DUF4393 domain-containing protein -
  NY10_RS02120 (NY10_449) - 396902..398488 (+) 1587 WP_058918443.1 hypothetical protein -
  NY10_RS02125 (NY10_450) - 398485..398736 (+) 252 WP_058918444.1 hypothetical protein -
  NY10_RS12560 (NY10_451) - 398752..398895 (+) 144 WP_156413255.1 hypothetical protein -
  NY10_RS02130 (NY10_452) - 399037..400032 (+) 996 WP_058918445.1 acyltransferase -
  NY10_RS12650 (NY10_453) - 400134..400304 (+) 171 WP_058918446.1 hypothetical protein -
  NY10_RS02140 (NY10_454) - 400505..401125 (+) 621 WP_058918447.1 SEC-C metal-binding domain-containing protein -
  NY10_RS02150 (NY10_455) - 401401..401778 (+) 378 WP_058918449.1 hypothetical protein -
  NY10_RS02155 (NY10_456) - 401790..402053 (+) 264 WP_058918450.1 phage holin -
  NY10_RS02160 (NY10_457) - 402053..403048 (+) 996 WP_058918451.1 LysM peptidoglycan-binding domain-containing protein -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17093.85 Da        Isoelectric Point: 4.7410

>NTDB_id=139834 NY10_RS01970 WP_058918415.1 374104..374574(+) (ssb) [Carnobacterium sp. CP1]
MINNVVLVGRLTKELDLRYTANGTAVASFTTAVNRQFTNQKGERDADFINCVIWRKAAENMASYTKKGSLVGLEGRLQTR
SYDNQQGQRVYVTEVVVETFSLLESKSKNTAEQSSGSVPTGPSPAPNRSQGSDAPQNDPFENSSQPIDISDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=139834 NY10_RS01970 WP_058918415.1 374104..374574(+) (ssb) [Carnobacterium sp. CP1]
ATGATTAACAACGTTGTTTTAGTTGGACGATTAACAAAAGAATTAGATTTACGCTATACAGCAAATGGAACCGCAGTTGC
TTCCTTTACGACAGCTGTAAATAGACAGTTCACCAACCAAAAAGGAGAACGTGATGCAGACTTCATTAATTGTGTCATCT
GGCGCAAGGCTGCAGAGAACATGGCTAGCTATACAAAAAAAGGATCACTCGTTGGCTTAGAAGGACGACTTCAAACAAGA
TCCTATGATAATCAACAAGGACAACGAGTTTATGTGACAGAAGTAGTAGTTGAAACATTCTCATTACTTGAATCAAAGAG
TAAAAATACGGCTGAGCAATCAAGTGGAAGTGTACCTACTGGACCATCACCAGCTCCTAATCGGTCACAAGGAAGTGATG
CTCCACAAAATGACCCATTTGAAAACAGCAGCCAACCGATAGACATATCAGATGATGACTTGCCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0U3MAP3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.659

100

0.673
  ssbA Bacillus subtilis subsp. subtilis str. 168

53.488

100

0.59
  ssbB Bacillus subtilis subsp. subtilis str. 168

57.658

71.154

0.41

Multiple sequence alignment