Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NY10_RS00475 | Genome accession | NZ_CP010796 |
| Coordinates | 82429..82899 (+) | Length | 156 a.a. |
| NCBI ID | WP_058918143.1 | Uniprot ID | A0A0U3MJP7 |
| Organism | Carnobacterium sp. CP1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 69284..116331 | 82429..82899 | within | 0 |
Gene organization within MGE regions
Location: 69284..116331
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NY10_RS00370 (NY10_89) | - | 69284..70456 (-) | 1173 | WP_197408969.1 | site-specific integrase | - |
| NY10_RS00375 (NY10_90) | - | 70586..71248 (-) | 663 | WP_058918124.1 | hypothetical protein | - |
| NY10_RS00380 | - | 71248..71646 (-) | 399 | WP_058918125.1 | hypothetical protein | - |
| NY10_RS00385 (NY10_91) | - | 71639..72604 (-) | 966 | WP_058918126.1 | AAA family ATPase | - |
| NY10_RS00390 (NY10_92) | - | 72709..73239 (-) | 531 | WP_058918127.1 | PH domain-containing protein | - |
| NY10_RS00395 (NY10_94) | - | 73445..73789 (-) | 345 | WP_058918128.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NY10_RS00400 (NY10_95) | - | 73800..74120 (-) | 321 | WP_058918129.1 | helix-turn-helix transcriptional regulator | - |
| NY10_RS00405 (NY10_96) | - | 74398..74592 (+) | 195 | WP_058918130.1 | helix-turn-helix transcriptional regulator | - |
| NY10_RS00410 (NY10_97) | - | 74593..75312 (+) | 720 | WP_058918131.1 | ORF6C domain-containing protein | - |
| NY10_RS00415 (NY10_98) | - | 75315..75575 (+) | 261 | WP_058918132.1 | hypothetical protein | - |
| NY10_RS00420 | - | 75852..76136 (+) | 285 | WP_058918133.1 | hypothetical protein | - |
| NY10_RS00425 (NY10_100) | - | 76149..76334 (+) | 186 | WP_058918134.1 | hypothetical protein | - |
| NY10_RS00430 (NY10_101) | - | 76345..76551 (+) | 207 | WP_058918135.1 | hypothetical protein | - |
| NY10_RS00435 (NY10_102) | - | 76605..78620 (+) | 2016 | WP_058918136.1 | AAA family ATPase | - |
| NY10_RS00440 (NY10_103) | bet | 78623..79396 (+) | 774 | WP_058918137.1 | phage recombination protein Bet | - |
| NY10_RS00445 (NY10_104) | - | 79399..80094 (+) | 696 | WP_058918138.1 | MBL fold metallo-hydrolase | - |
| NY10_RS12645 (NY10_105) | - | 80110..81081 (+) | 972 | WP_058918139.1 | Lin1244/Lin1753 domain-containing protein | - |
| NY10_RS00455 (NY10_106) | - | 81086..81325 (+) | 240 | WP_058918140.1 | hypothetical protein | - |
| NY10_RS00460 (NY10_107) | - | 81318..81896 (+) | 579 | WP_082664140.1 | Holliday junction resolvase RecU | - |
| NY10_RS00465 (NY10_108) | - | 81918..82205 (+) | 288 | WP_058918141.1 | hypothetical protein | - |
| NY10_RS00470 (NY10_109) | - | 82198..82428 (+) | 231 | WP_058918142.1 | hypothetical protein | - |
| NY10_RS00475 (NY10_110) | ssb | 82429..82899 (+) | 471 | WP_058918143.1 | single-stranded DNA-binding protein | Machinery gene |
| NY10_RS00480 (NY10_111) | - | 82935..83249 (+) | 315 | WP_058918144.1 | MazG-like family protein | - |
| NY10_RS00485 (NY10_112) | - | 83254..83487 (+) | 234 | WP_058918145.1 | helix-turn-helix transcriptional regulator | - |
| NY10_RS00490 (NY10_113) | - | 83484..83675 (+) | 192 | WP_058918146.1 | hypothetical protein | - |
| NY10_RS00495 (NY10_114) | - | 83672..83941 (+) | 270 | WP_058918147.1 | hypothetical protein | - |
| NY10_RS00500 (NY10_115) | - | 83997..84368 (+) | 372 | WP_156413239.1 | DUF722 domain-containing protein | - |
| NY10_RS00510 (NY10_116) | - | 84826..85041 (+) | 216 | WP_058918149.1 | hypothetical protein | - |
| NY10_RS00515 (NY10_117) | terS | 85132..85929 (+) | 798 | WP_058918150.1 | phage terminase small subunit | - |
| NY10_RS00520 (NY10_118) | - | 85919..87211 (+) | 1293 | WP_058918151.1 | PBSX family phage terminase large subunit | - |
| NY10_RS00525 (NY10_119) | - | 87223..88626 (+) | 1404 | WP_058918152.1 | phage portal protein | - |
| NY10_RS00530 (NY10_120) | - | 88607..88882 (+) | 276 | WP_058918153.1 | hypothetical protein | - |
| NY10_RS00535 (NY10_121) | - | 88879..89190 (+) | 312 | WP_058918154.1 | ribosomal-processing cysteine protease Prp | - |
| NY10_RS00540 (NY10_122) | - | 89253..89885 (+) | 633 | WP_058918155.1 | DUF4145 domain-containing protein | - |
| NY10_RS00545 (NY10_123) | - | 89925..91625 (+) | 1701 | WP_082664141.1 | minor capsid protein | - |
| NY10_RS00550 (NY10_124) | - | 91609..91863 (+) | 255 | WP_058918156.1 | hypothetical protein | - |
| NY10_RS00555 (NY10_125) | - | 91924..92121 (+) | 198 | WP_058918157.1 | hypothetical protein | - |
| NY10_RS12510 (NY10_126) | - | 92131..92280 (+) | 150 | WP_156413240.1 | hypothetical protein | - |
| NY10_RS00560 (NY10_127) | - | 92300..92632 (+) | 333 | WP_058918158.1 | RyR domain-containing protein | - |
| NY10_RS00565 (NY10_128) | - | 92838..93518 (+) | 681 | WP_058918159.1 | DUF4355 domain-containing protein | - |
| NY10_RS00570 (NY10_129) | - | 93536..93850 (+) | 315 | WP_058918160.1 | hypothetical protein | - |
| NY10_RS00575 (NY10_130) | - | 93878..94945 (+) | 1068 | WP_058918161.1 | major capsid protein | - |
| NY10_RS00580 (NY10_131) | - | 94965..95225 (+) | 261 | WP_058918162.1 | hypothetical protein | - |
| NY10_RS00585 (NY10_132) | - | 95241..95558 (+) | 318 | WP_058918163.1 | hypothetical protein | - |
| NY10_RS00590 (NY10_133) | - | 95570..95902 (+) | 333 | WP_058918164.1 | phage head-tail connector protein | - |
| NY10_RS00595 (NY10_134) | - | 95899..96330 (+) | 432 | WP_058918165.1 | hypothetical protein | - |
| NY10_RS00600 (NY10_135) | - | 96335..96880 (+) | 546 | WP_058918166.1 | hypothetical protein | - |
| NY10_RS00605 (NY10_136) | - | 96880..97242 (+) | 363 | WP_058918167.1 | hypothetical protein | - |
| NY10_RS00610 (NY10_137) | - | 97262..97741 (+) | 480 | WP_156413241.1 | phage tail tube protein | - |
| NY10_RS00615 (NY10_138) | - | 97871..98281 (+) | 411 | WP_058918168.1 | DUF6096 family protein | - |
| NY10_RS00620 (NY10_139) | - | 98317..98670 (+) | 354 | WP_058918169.1 | hypothetical protein | - |
| NY10_RS12925 (NY10_140) | - | 98671..103764 (+) | 5094 | WP_058918170.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| NY10_RS00630 (NY10_141) | - | 103780..104145 (+) | 366 | WP_058918171.1 | DUF6711 family protein | - |
| NY10_RS00635 (NY10_142) | - | 104159..108985 (+) | 4827 | WP_058918172.1 | tail fiber domain-containing protein | - |
| NY10_RS12515 (NY10_143) | - | 108989..109132 (+) | 144 | WP_156413242.1 | hypothetical protein | - |
| NY10_RS00640 (NY10_144) | - | 109134..109334 (+) | 201 | WP_058918173.1 | hypothetical protein | - |
| NY10_RS00645 (NY10_145) | - | 109422..109712 (+) | 291 | WP_058918174.1 | hypothetical protein | - |
| NY10_RS00650 (NY10_146) | - | 109839..110177 (+) | 339 | WP_058918175.1 | helix-turn-helix domain-containing protein | - |
| NY10_RS00655 (NY10_147) | - | 110280..110696 (+) | 417 | WP_058918176.1 | hypothetical protein | - |
| NY10_RS00660 (NY10_148) | - | 110686..110976 (+) | 291 | WP_058918177.1 | hypothetical protein | - |
| NY10_RS00665 (NY10_149) | - | 110973..111254 (+) | 282 | WP_058918178.1 | holin | - |
| NY10_RS00670 (NY10_150) | - | 111257..112231 (+) | 975 | WP_058918179.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NY10_RS00675 (NY10_151) | - | 112414..113691 (+) | 1278 | WP_058918180.1 | DNA/RNA non-specific endonuclease | - |
| NY10_RS00680 (NY10_152) | - | 113800..114312 (+) | 513 | WP_058918181.1 | hypothetical protein | - |
| NY10_RS00685 (NY10_153) | - | 114330..114641 (-) | 312 | WP_058918182.1 | ssDNA-binding protein | - |
| NY10_RS00690 (NY10_154) | - | 114665..115036 (-) | 372 | WP_058918183.1 | hypothetical protein | - |
| NY10_RS00695 (NY10_155) | - | 115033..116331 (-) | 1299 | WP_058918184.1 | Y-family DNA polymerase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 16941.52 Da Isoelectric Point: 4.9116
>NTDB_id=139828 NY10_RS00475 WP_058918143.1 82429..82899(+) (ssb) [Carnobacterium sp. CP1]
MMNNTVLVGRLTKDADLRYTANGIAVASFTVAVNRAYKKENDEQKADFINCVVWRKTAEALANYTKKGSLIGVEGSIQTR
SYDNQQGQRVYVTEVNAREITFLESKKTSAGEGSTNQQTNSQSYSSNSTIGSSQSQTTGYDAGGTPADISDDDLPF
MMNNTVLVGRLTKDADLRYTANGIAVASFTVAVNRAYKKENDEQKADFINCVVWRKTAEALANYTKKGSLIGVEGSIQTR
SYDNQQGQRVYVTEVNAREITFLESKKTSAGEGSTNQQTNSQSYSSNSTIGSSQSQTTGYDAGGTPADISDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=139828 NY10_RS00475 WP_058918143.1 82429..82899(+) (ssb) [Carnobacterium sp. CP1]
ATGATGAATAACACGGTTTTAGTTGGAAGATTAACAAAGGATGCGGATTTAAGATACACAGCGAATGGCATAGCAGTTGC
TTCATTCACTGTTGCGGTAAATCGTGCATATAAAAAAGAAAATGATGAACAGAAAGCTGATTTCATCAATTGTGTGGTGT
GGAGAAAAACCGCTGAAGCTTTAGCGAACTACACGAAAAAAGGTTCACTAATAGGCGTGGAAGGAAGTATTCAAACACGA
AGCTATGATAATCAACAAGGACAAAGAGTCTATGTTACGGAAGTTAACGCAAGGGAAATAACCTTCTTAGAAAGCAAAAA
AACCAGCGCAGGAGAAGGTTCAACTAATCAACAGACAAATAGTCAAAGTTATAGTTCAAATTCAACAATAGGCAGTAGTC
AAAGTCAAACGACAGGTTATGATGCTGGCGGAACTCCAGCGGACATCTCTGATGATGATTTACCGTTTTAA
ATGATGAATAACACGGTTTTAGTTGGAAGATTAACAAAGGATGCGGATTTAAGATACACAGCGAATGGCATAGCAGTTGC
TTCATTCACTGTTGCGGTAAATCGTGCATATAAAAAAGAAAATGATGAACAGAAAGCTGATTTCATCAATTGTGTGGTGT
GGAGAAAAACCGCTGAAGCTTTAGCGAACTACACGAAAAAAGGTTCACTAATAGGCGTGGAAGGAAGTATTCAAACACGA
AGCTATGATAATCAACAAGGACAAAGAGTCTATGTTACGGAAGTTAACGCAAGGGAAATAACCTTCTTAGAAAGCAAAAA
AACCAGCGCAGGAGAAGGTTCAACTAATCAACAGACAAATAGTCAAAGTTATAGTTCAAATTCAACAATAGGCAGTAGTC
AAAGTCAAACGACAGGTTATGATGCTGGCGGAACTCCAGCGGACATCTCTGATGATGATTTACCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.136 |
100 |
0.577 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.256 |
100 |
0.532 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
67.949 |
0.397 |