Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   SB45_RS11515 Genome accession   NZ_CP010556
Coordinates   2449908..2450285 (-) Length   125 a.a.
NCBI ID   WP_043867284.1    Uniprot ID   -
Organism   Bacillus velezensis strain L-H15     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2444908..2455285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SB45_RS11475 (SB45_11475) - 2445407..2446201 (+) 795 WP_014305407.1 YqhG family protein -
  SB45_RS11480 (SB45_11480) sinI 2446378..2446551 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  SB45_RS11485 (SB45_11485) sinR 2446585..2446920 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SB45_RS11490 (SB45_11490) - 2446968..2447753 (-) 786 WP_003153102.1 TasA family protein -
  SB45_RS11495 (SB45_11495) - 2447817..2448401 (-) 585 WP_012117977.1 signal peptidase I -
  SB45_RS11500 (SB45_11500) tapA 2448373..2449044 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  SB45_RS11505 (SB45_11505) - 2449303..2449632 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  SB45_RS11510 (SB45_11510) - 2449672..2449851 (-) 180 WP_003153093.1 YqzE family protein -
  SB45_RS11515 (SB45_11515) comGG 2449908..2450285 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  SB45_RS11520 (SB45_11520) comGF 2450286..2450786 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  SB45_RS11525 (SB45_11525) comGE 2450695..2451009 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  SB45_RS11530 (SB45_11530) comGD 2450993..2451430 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  SB45_RS11535 (SB45_11535) comGC 2451420..2451728 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  SB45_RS11540 (SB45_11540) comGB 2451733..2452770 (-) 1038 WP_043867286.1 competence type IV pilus assembly protein ComGB Machinery gene
  SB45_RS11545 (SB45_11545) comGA 2452757..2453827 (-) 1071 WP_043867287.1 competence type IV pilus ATPase ComGA Machinery gene
  SB45_RS11550 (SB45_11550) - 2454025..2454975 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14200.16 Da        Isoelectric Point: 9.9592

>NTDB_id=139263 SB45_RS11515 WP_043867284.1 2449908..2450285(-) (comGG) [Bacillus velezensis strain L-H15]
MYKSDGFIYPTVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=139263 SB45_RS11515 WP_043867284.1 2449908..2450285(-) (comGG) [Bacillus velezensis strain L-H15]
ATGTACAAATCTGACGGTTTTATCTATCCCACGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment