Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | SB45_RS11480 | Genome accession | NZ_CP010556 |
| Coordinates | 2446378..2446551 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain L-H15 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2441378..2451551
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SB45_RS11465 (SB45_11465) | gcvT | 2442196..2443296 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SB45_RS11470 (SB45_11470) | - | 2443719..2445389 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| SB45_RS11475 (SB45_11475) | - | 2445407..2446201 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| SB45_RS11480 (SB45_11480) | sinI | 2446378..2446551 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| SB45_RS11485 (SB45_11485) | sinR | 2446585..2446920 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| SB45_RS11490 (SB45_11490) | - | 2446968..2447753 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| SB45_RS11495 (SB45_11495) | - | 2447817..2448401 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| SB45_RS11500 (SB45_11500) | tapA | 2448373..2449044 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| SB45_RS11505 (SB45_11505) | - | 2449303..2449632 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| SB45_RS11510 (SB45_11510) | - | 2449672..2449851 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| SB45_RS11515 (SB45_11515) | comGG | 2449908..2450285 (-) | 378 | WP_043867284.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SB45_RS11520 (SB45_11520) | comGF | 2450286..2450786 (-) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| SB45_RS11525 (SB45_11525) | comGE | 2450695..2451009 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SB45_RS11530 (SB45_11530) | comGD | 2450993..2451430 (-) | 438 | WP_043867285.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=139261 SB45_RS11480 WP_003153105.1 2446378..2446551(+) (sinI) [Bacillus velezensis strain L-H15]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=139261 SB45_RS11480 WP_003153105.1 2446378..2446551(+) (sinI) [Bacillus velezensis strain L-H15]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |